9UOK: Complex of LGR4_ECD with Norrin

Structure of the complex of LGR4_ECD with Norrin. Determined by electron microscopy at 3.05 Å resolution. Released 16 Jul 2025.

Method: Electron microscopy
Resolution: 3.05 Å
Organisms: Camelus ferus, Homo sapiens
Chains: 4
Atoms: 5,851
Mol. weight: 255.29 kDa
Released: 16 Jul 2025

Explore 9UOK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9UOK contains 12 α-helices and 61 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	424-426	3	1
β-strand	439-445	7	2
β-strand	451-458	8	2
β-strand	463-465	3	2
α-helix	467-469	3
β-strand	473-475	3	1
β-strand	478	1	3
β-strand	483	1	3
β-strand	486-488	3	1
α-helix	493-495	3
β-strand	497-504	8	2
β-strand	520-521	2	2
β-strand	525-527	3	2

Chain C: 7 helices, 30 β-strands

Element	Residues	Length	Sheet
β-strand	36	1	4
β-strand	40-42	3	4
α-helix	51-53	3
β-strand	61-63	3	4
β-strand	71-72	2	5
β-strand	85-87	3	4
β-strand	95-96	2	5
β-strand	109-111	3	4
β-strand	119	1	6
α-helix	122-125	4
β-strand	133-135	3	4
β-strand	143	1	6
β-strand	157-159	3	4
α-helix	170-174	5
β-strand	181-183	3	4
β-strand	191-192	2	7
β-strand	205-207	3	4
β-strand	215-216	2	7
β-strand	229-231	3	4
α-helix	242-246	5
β-strand	252-254	3	4
β-strand	262-263	2	8
β-strand	276-278	3	4
β-strand	286-287	2	8
β-strand	300-304	5	4
α-helix	312-313	2
β-strand	323-327	5	4
α-helix	338-341	4
β-strand	347-349	3	4
β-strand	369-371	3	4
β-strand	380	1	9
β-strand	393-395	3	4
β-strand	404	1	9
α-helix	406-409	4
β-strand	417-419	3	4
β-strand	438-440	3	4
β-strand	461-463	3	4

Chain E: 1 helix, 11 β-strands

Element	Residues	Length	Sheet
β-strand	40-46	7	10
β-strand	55	1	11
β-strand	60-67	8	10
α-helix	72	1
β-strand	73-77	5	12
β-strand	80	1	13
β-strand	89-92	4	12
β-strand	94-97	4	14
β-strand	101-109	9	15
β-strand	110	1	11
β-strand	115-123	9	15
β-strand	127-130	4	14

Chain F: 2 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	40-48	9	12
β-strand	55	1	16
β-strand	58-67	10	12
α-helix	72	1
β-strand	73-77	5	10
β-strand	79-80	2	15
β-strand	89-92	4	10
β-strand	94-109	16	13
β-strand	110	1	16
α-helix	111-113	3
β-strand	115-130	16	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
MB52	A	protein	556	Camelus ferus	B5Z8H1 (AlphaFold model)
Leucine-rich repeat-containing G-protein coupled receptor 4	C	protein	954	Homo sapiens	Q9BXB1 (AlphaFold model)
Norrin,Immunoglobulin gamma-1 heavy chain	E, F	protein	409	Homo sapiens	Q00604 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9UOK_1 MB52 (chains A)
MKKIWLALAGLVLAFSASAQVQLVESGGGLVQTKTTTSVIDTTNDAQNLLTQAQTIVNTL
KDYCPILIAKSSSSNGGTNNANTPSWQTAGGGKNSCATFGAEFSAASDMINNAQKIVQET
QQLSANQPKNITQPHNLNLNSPSSLTALAQKMLKNAQSQAEILKLANQVESDFNKLSSGH
LKDYIGKCDASAISSANMTMQNQKNNWGNGCAGVEETQSLLKTSAADFNNQTPQINQAQN
LANTLIQELGNNPFRASGGGSGGGGSGKLSDTYEQLSRLLTNDNGTNSKTSAQAINQAVN
NLNERAKTLAGGTTNSPAYQATLLALRSVLGLWNSMGYAVICGGYTKSPGENNQKDFHYT
DENGNGTTINCGGSTNSNGTHSYNGTNTLKADKNVSLSIEQYEKIHEAYQILSKALKQAG
LAPLNSKGEKLEAHVTTSKYGSLRLSCAASGYTYSPYCMGWFRQAPGKAREGVATVDLDG
STIYADSVKGRFTISQDNAKNTLYLQMNSLKPEDTAMYYCASRTRAGVTCGLNWAIFSYW
GQGTQVTVSSHHHHHH

Sequence of entity 2 (C), FASTA

>9UOK_2 Leucine-rich repeat-containing G-protein coupled receptor 4 (chains C)
MKTIIALSYIFCLVFAAPPLCAAPCSCDGDRRVDCSGKGLTAVPEGLSAFTQALDISMNN
ITQLPEDAFKNFPFLEELQLAGNDLSFIHPKALSGLKELKVLTLQNNQLKTVPSEAIRGL
SALQSLRLDANHITSVPEDSFEGLVQLRHLWLDDNSLTEVPVHPLSNLPTLQALTLALNK
ISSIPDFAFTNLSSLVVLHLHNNKIRSLSQHCFDGLDNLETLDLNYNNLGEFPQAIKALP
SLKELGFHSNSISVIPDGAFDGNPLLRTIHLYDNPLSFVGNSAFHNLSDLHSLVIRGASM
VQQFPNLTGTVHLESLTLTGTKISSIPNNLCQEQKMLRTLDLSYNNIRDLPSFNGCHALE
EISLQRNQIYQIKEGTFQGLISLRILDLSRNLIHEIHSRAFATLGPITNLDVSFNELTSF
PTEGLNGLNQLKLVGNFKLKEALAAKDFVNLRSLSVPYAYQCCAFWGCDSYANLNTEDNS
LQDHSVAQEKGTADAANVTSTLENEEHSQIIIHCTPSTGAFKPCEYLLGSWMIRLTVWFI
FLVALFFNLLVILTTFASCTSLPSSKLFIGLISVSNLFMGIYTGILTFLDAVSWGRFAEF
GIWWETGSGCKVAGFLAVFSSESAIFLLMLATVERSLSAKDIMKNGKSNHLKQFRVAALL
AFLGATVAGCFPLFHRGEYSASPLCLPFPTGETPSLGFTVTLVLLNSLAFLLMAVIYTKL
YCNLEKEDLSENSQSSMIKHVAWLIFTNCIFFCPVAFFSFAPLITAISISPEIMKSVTLI
FFPLPACLNPVLYVFFNPKFKEDWKLLKRRVTKKSGSVSVSISSQGGCLEQDFYYDCGMY
SHLQGNLTVCDCCESFLLTKPVSCKHLIKSHSCPALAVASCQRPEGYWSDCGTQSAHSDY
ADEEDSFVSDSSDQVQACGRACFYQSRGFPLVRYAYNLPRVKDAAADYKDDDDK

Sequence of entity 3 (E, F), FASTA

>9UOK_3 Norrin,Immunoglobulin gamma-1 heavy chain (chains E, F)
MLLVNQSHQGFNKEHTSKMVSAIVLYVLLAAAAHSAFAKTDSSFIMDSDPRRCMRHHYVD
SISHPLYKCSSKMVLLARCEGHCSQASRSEPLVSFSTVLKQPFRSSCHCCRPQTSKLKAL
RLRCSGGMRLTATYRYILSCHCEECNSGGSGGSGGLEVLFQGPGGSGGSGGKSCDKTHTC
PPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHN
AKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREP
QVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKATPPVLDSDGSFFL
YSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKDYKDDDDK

Primary citation

Distinct structural mechanisms of LGR4 modulation by Norrin and RSPOs in Wnt/ beta-catenin signaling. Qiao, H., Hu, F., Wang, Y. et al. Nat Commun (2025) 16:6256-6256. DOI 10.1038/s41467-025-61545-z · PubMed

Other PDB entries of the same protein (UniProt B5Z8H1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6QFA 2.49 Å, CryoEM structure of a beta3K279T GABA(A)R homomer in complex with histamine and megabody…
9FFU 2.5 Å, Cryo-EM structure of the alpha1beta3 GABA(A) receptor in complex with GABA and Mb25 in…
6XVI 2.6 Å, Crystal structure of Megabody Mb-Nb207-c7HopQ_A12
5LP2 2.6 Å, Adhesin domain of the type 1 HopQ of Helicobacter pylori strain G27
9FAJ 2.6 Å, CryoEM structure of human full-length alpha1beta3gamma2 GABA(A) receptor in complex with…
6GBG 2.8 Å, Helicobacter pylori adhesin HopQ type I bound to the N-terminal domain of human CEACAM1
9FFL 2.8 Å, Cryo-EM structure of the alpha1beta3 GABA(A) receptor in complex with GABA and Mb25 in…
6QD6 2.84 Å, Molecular scaffolds expand the nanobody toolkit for cryo-EM applications: crystal…
7QHA 2.97 Å, Cryo-EM structure of the Tripartite ATP-independent Periplasmic (TRAP) transporter SiaQM…
9FFM 3.0 Å, Cryo-EM structure of the alpha1beta3 GABA(A) receptor in complex with Mb25 in the…
9FFN 3.1 Å, Cryo-EM structure of the alpha1beta3 GABA(A) receptor in complex with GABA and Mb25 in…
9FFQ 3.1 Å, Cryo-EM structure of the alpha1beta3 GABA(A) receptor in complex with GABA and Mb25 in…

Browse structure collections

About this viewer

MolViewer shows 9UOK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.