5LPK: Bromodomain of human EP300
Crystal structure of the bromodomain of human EP300 bound to the inhibitor XDM1. Determined by X-ray diffraction at 2.1 Å resolution. Released 16 Aug 2017.
- Method
- X-ray diffraction
- Resolution
- 2.1 Å
- Organism
- Homo sapiens
- Chains
- 7
- Atoms
- 7,515
- Mol. weight
- 105.14 kDa
- Ligands
- XDM
- Released
- 16 Aug 2017
Explore 5LPK in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
5LPK contains 49 α-helices and 0 β-strands across 7 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 7 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 1051-1067 | 17 | |
| α-helix | 1073-1075 | 3 | |
| α-helix | 1081-1084 | 4 | |
| α-helix | 1089-1092 | 4 | |
| α-helix | 1099-1107 | 9 | |
| α-helix | 1114-1131 | 18 | |
| α-helix | 1137-1159 | 23 | |
Chain B: 7 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 1051-1066 | 16 | |
| α-helix | 1073-1075 | 3 | |
| α-helix | 1081-1084 | 4 | |
| α-helix | 1089-1092 | 4 | |
| α-helix | 1099-1107 | 9 | |
| α-helix | 1114-1131 | 18 | |
| α-helix | 1137-1158 | 22 | |
Chains C and D: 7 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 1051-1067 | 17 | |
| α-helix | 1073-1075 | 3 | |
| α-helix | 1081-1084 | 4 | |
| α-helix | 1089-1092 | 4 | |
| α-helix | 1099-1107 | 9 | |
| α-helix | 1114-1131 | 18 | |
| α-helix | 1137-1160 | 24 | |
Chain E: 7 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 1051-1067 | 17 | |
| α-helix | 1073-1075 | 3 | |
| α-helix | 1081-1084 | 4 | |
| α-helix | 1089-1092 | 4 | |
| α-helix | 1099-1107 | 9 | |
| α-helix | 1114-1131 | 18 | |
| α-helix | 1137-1156 | 20 | |
Chain F: 7 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 1051-1066 | 16 | |
| α-helix | 1073-1075 | 3 | |
| α-helix | 1081-1084 | 4 | |
| α-helix | 1089-1092 | 4 | |
| α-helix | 1099-1108 | 10 | |
| α-helix | 1114-1131 | 18 | |
| α-helix | 1137-1158 | 22 | |
Chain G: 7 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 1051-1067 | 17 | |
| α-helix | 1073-1075 | 3 | |
| α-helix | 1081-1084 | 4 | |
| α-helix | 1089-1092 | 4 | |
| α-helix | 1099-1107 | 9 | |
| α-helix | 1114-1131 | 18 | |
| α-helix | 1137-1158 | 22 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Histone acetyltransferase p300 | A, B, C, D, E, F, G | protein | 122 | Homo sapiens | Q09472 (AlphaFold model) |
Sequence of entity 1 (A, B, C, D, E, F, G), FASTA
>5LPK_1 Histone acetyltransferase p300 (chains A, B, C, D, E, F, G)
APGQSKKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKSPMDL
STIKRKLDTGQYQEPWQYVDDIWLMFNNAWLYNRKTSRVYKYCSKLSEVFEQEIDPVMQS
LG
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| XDM | ~{N}-[(3-chlorophenyl)methyl]-4-ethanoyl-3-ethyl-5-methyl-1~{H}-pyrrole-2-carbo… | C17 H19 Cl N2 O2 | 7 |
Water and common crystallization additives (PG4, EDO, SO4) are not listed.
Primary citation
Beyond the BET Family: Targeting CBP/p300 with 4-Acyl Pyrroles. Hugle, M., Lucas, X., Ostrovskyi, D. et al. Angew Chem Int Ed Engl (2017) 56:12476-12480. DOI 10.1002/anie.201705516 · PubMed
Other PDB entries of the same protein (UniProt Q09472 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 5BT3 1.05 Å, Crystal structure of EP300 bromodomain in complex with SGC-CBP30 chemical probe
- 3T92 1.5 Å, Crystal structure of the Taz2:C/EBPepsilon-TAD chimera protein
- 5LPM 1.5 Å, Crystal structure of the bromodomain of human Ep300 bound to the inhibitor XDM3d
- 5NU5 1.6 Å, Crystal structure of the human bromodomain of EP300 bound to the inhibitor XDM-CBP
- 3BIY 1.7 Å, Crystal structure of p300 histone acetyltransferase domain in complex with a bisubstrate…
- 6PGU 1.72 Å, Crystal structure of the p300 acetyltransferase domain with allosteric inhibitor CPI-076…
- 6V8K 1.84 Å, Crystal structure of the p300 acetyltransferase domain with peptide-competitive…
- 4PZS 1.94 Å, Crystal structure of p300 histone acetyltransferase domain in complex with…
- 5KJ2 1.95 Å, The novel p300/CBP inhibitor A-485 uncovers a unique mechanism of action to target AR in…
- 6DS6 1.95 Å, Crystal structure of p300 ZZ domain in complex with histone H3 peptide
- 7QGS 2.0 Å, Crystal structure of p300 CH1 domain in complex with CITIF (a CITED2-HIF-1alpha hybrid)
- 7UGI 2.0 Å, Bromodomain of EP300 liganded with BMS-536924
Browse structure collections
About this viewer
MolViewer shows 5LPK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.