nucleotide-free kinesin-1 motor domain T92V mutant, P21 crystal form. Determined by X-ray diffraction at 1.95 Å resolution. Released 1 Mar 2017.
Explore 5LT1 in 3D Show helices and sheets RCSB PDB PDBe
5LT1 contains 32 α-helices and 38 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 9-15 | 7 | 1 |
| α-helix | 16-18 | 3 | |
| α-helix | 20-25 | 6 | |
| β-strand | 29 | 1 | 2 |
| β-strand | 32-34 | 3 | 3 |
| β-strand | 38-41 | 4 | 3 |
| β-strand | 44-47 | 4 | 3 |
| β-strand | 50-52 | 3 | 1 |
| α-helix | 58-65 | 8 | |
| α-helix | 67-74 | 8 | |
| β-strand | 79-84 | 6 | 1 |
| α-helix | 91-95 | 5 | |
| β-strand | 97 | 1 | 4 |
| β-strand | 105 | 1 | 4 |
| α-helix | 107-121 | 15 | |
| β-strand | 126-138 | 13 | 1 |
| β-strand | 141-144 | 4 | 1 |
| β-strand | 153 | 1 | 1 |
| α-helix | 154 | 1 | |
| β-strand | 155-157 | 3 | 5 |
| β-strand | 163-165 | 3 | 5 |
| β-strand | 171-172 | 2 | 1 |
| α-helix | 176-189 | 14 | |
| α-helix | 197-202 | 6 | |
| β-strand | 205-216 | 12 | 1 |
| β-strand | 221-231 | 11 | 1 |
| α-helix | 232-234 | 3 | |
| α-helix | 249-269 | 21 | |
| α-helix | 277-279 | 3 | |
| α-helix | 281-285 | 5 | |
| β-strand | 295-302 | 8 | 1 |
| β-strand | 305 | 1 | 2 |
| α-helix | 306-308 | 3 | |
| α-helix | 309-320 | 12 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 8-9 | 2 | |
| β-strand | 10-15 | 6 | 6 |
| α-helix | 16-19 | 4 | |
| α-helix | 20-25 | 6 | |
| β-strand | 29 | 1 | 7 |
| β-strand | 32-34 | 3 | 8 |
| β-strand | 38-41 | 4 | 8 |
| β-strand | 44-47 | 4 | 8 |
| β-strand | 50-52 | 3 | 6 |
| α-helix | 58-65 | 8 | |
| α-helix | 67-73 | 7 | |
| β-strand | 79-84 | 6 | 6 |
| α-helix | 91-95 | 5 | |
| β-strand | 97 | 1 | 9 |
| β-strand | 105 | 1 | 9 |
| α-helix | 107-121 | 15 | |
| β-strand | 126-138 | 13 | 6 |
| β-strand | 141-144 | 4 | 6 |
| β-strand | 153 | 1 | 6 |
| α-helix | 154 | 1 | |
| β-strand | 155-157 | 3 | 10 |
| β-strand | 163-165 | 3 | 10 |
| β-strand | 171-173 | 3 | 6 |
| α-helix | 176-189 | 14 | |
| α-helix | 197-202 | 6 | |
| β-strand | 205-216 | 12 | 6 |
| β-strand | 222-231 | 10 | 6 |
| α-helix | 232-234 | 3 | |
| α-helix | 249-269 | 21 | |
| α-helix | 277-279 | 3 | |
| α-helix | 281-285 | 5 | |
| α-helix | 287-289 | 3 | |
| β-strand | 295-302 | 8 | 6 |
| β-strand | 305 | 1 | 7 |
| α-helix | 306-308 | 3 | |
| α-helix | 309-320 | 12 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Kinesin-like protein | A, B | protein | 325 | Homo sapiens | P33176 (AlphaFold model) |
>5LT1_1 Kinesin-like protein (chains A, B) MADLAESNIKVMCRFRPLNESEVNRGDKYIAKFQGEDTVVIASKPYAFDRVFQSSTSQEQ VYNDAAKKIVKDVLEGYNGTIFAYGQTSSGKVHTMEGKLHDPEGMGIIPRIVQDIFNYIY SMDENLEFHIKVSYFEIYLDKIRDLLDVSKTNLSVHEDKNRVPYVKGATERFVSSPDEVM DTIDEGKSNRHVAVTNMNEHSSRSHSIFLINVKQENTQTEQKLSGKLYLVDLAGSEKVSK TGAEGAVLDEAKNINKSLSALGNVISALAEGSTYVPYRDSKMTRILQDSLGGNARTTIVI CCSPSSYNESETKSTLLFGQRAKTI
| ID | Name | Formula | Copies |
|---|---|---|---|
| SR | Strontium ion | Sr | 1 |
Water and common crystallization additives (SO4, ACT) are not listed.
The structural switch of nucleotide-free kinesin. Cao, L., Cantos-Fernandes, S., Gigant, B. Sci Rep (2017) 7:42558-42558. DOI 10.1038/srep42558 · PubMed
Other PDB entries of the same protein (UniProt P33176 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5LT1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.