Clathrin heavy chain N-terminal domain bound to beta2 adaptin clathrin box motif. Determined by X-ray diffraction at 1.76 Å resolution. Released 9 Nov 2016.
Explore 5M5R in 3D Show helices and sheets RCSB PDB PDBe
5M5R contains 10 α-helices and 30 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 7-14 | 8 | 1 |
| α-helix | 15-18 | 4 | |
| α-helix | 22-24 | 3 | |
| β-strand | 30-34 | 5 | 2 |
| β-strand | 37-44 | 8 | 2 |
| β-strand | 47-54 | 8 | 2 |
| β-strand | 62-65 | 4 | 2 |
| β-strand | 66 | 1 | 3 |
| β-strand | 70-73 | 4 | 4 |
| β-strand | 79-84 | 6 | 4 |
| β-strand | 87-92 | 6 | 4 |
| β-strand | 97-103 | 7 | 4 |
| β-strand | 108-113 | 6 | 5 |
| β-strand | 118-123 | 6 | 5 |
| β-strand | 126-131 | 6 | 5 |
| β-strand | 139-143 | 5 | 5 |
| α-helix | 144-145 | 2 | |
| α-helix | 146-148 | 3 | |
| α-helix | 151 | 1 | |
| β-strand | 152-158 | 7 | 6 |
| β-strand | 164-173 | 10 | 6 |
| β-strand | 176-185 | 10 | 6 |
| β-strand | 190-195 | 6 | 6 |
| β-strand | 198-204 | 7 | 7 |
| β-strand | 213-221 | 9 | 7 |
| β-strand | 226-232 | 7 | 7 |
| α-helix | 240-245 | 6 | |
| β-strand | 246-250 | 5 | 7 |
| β-strand | 261-267 | 7 | 8 |
| β-strand | 272-277 | 6 | 8 |
| β-strand | 281-286 | 6 | 8 |
| β-strand | 292-297 | 6 | 8 |
| α-helix | 302 | 1 | |
| β-strand | 303-309 | 7 | 1 |
| α-helix | 310-312 | 3 | |
| β-strand | 314-319 | 6 | 1 |
| β-strand | 323-329 | 7 | 1 |
| α-helix | 334-340 | 7 | |
| α-helix | 345-354 | 10 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 5 | 1 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Clathrin heavy chain 1 | A | protein | 365 | Bos taurus | P49951 (AlphaFold model) |
| AP-2 complex subunit beta | C, D | protein | 10 | Homo sapiens | P63010 (AlphaFold model) |
>5M5R_1 Clathrin heavy chain 1 (chains A) GSMAQILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDP SNPIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNT VALVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNRVV GAMQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPT GNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRI SGETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRMAVRNNLA GAEEL
>5M5R_2 AP-2 complex subunit beta (chains C, D) CGDLLNLDLG
Cellular and viral peptides bind multiple sites on the N-terminal domain of clathrin. Muenzner, J., Traub, L.M., Kelly, B.T. et al. Traffic (2017) 18:44-57. DOI 10.1111/tra.12457 · PubMed
Other PDB entries of the same protein (UniProt P49951 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5M5R directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.