5M6C: T71N mutant of human hippocalcin

Crystal structure of T71N mutant of human hippocalcin. Determined by X-ray diffraction at 3.0 Å resolution. Released 12 Apr 2017.

Method: X-ray diffraction
Resolution: 3.0 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,021
Mol. weight: 45.2 kDa
Ligands: CA
Released: 12 Apr 2017

Explore 5M6C in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5M6C contains 21 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	10-19	10
α-helix	24-37	14
β-strand	43	1	1
α-helix	45-52	8
α-helix	58-72	15
β-strand	80	1	1
α-helix	82-94	13
α-helix	97-108	12
β-strand	116-117	2	2
α-helix	118-132	15
α-helix	145-154	10
β-strand	163-164	2	2
α-helix	166-173	8
α-helix	177-183	7

Chain E: 11 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	10-19	10
α-helix	24-37	14
β-strand	43	1	3
α-helix	45-52	8
α-helix	58-72	15
β-strand	80	1	3
α-helix	82-94	13
α-helix	97-108	12
β-strand	116-117	2	4
α-helix	118-132	15
α-helix	140-142	3
α-helix	145-156	12
β-strand	163-164	2	4
α-helix	166-173	8
α-helix	177-183	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Neuron-specific calcium-binding protein hippocalcin	A	protein	193	Homo sapiens	P84074 (AlphaFold model)
Neuron-specific calcium-binding protein hippocalcin	E	protein	193	Homo sapiens	P84074 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5M6C_1 Neuron-specific calcium-binding protein hippocalcin (chains A)
MGKQNSKLRPEMLQDLRENTEFSELELQEWYKGFLKDCPTGILNVDEFKKIYANFFPYGD
ASKFAEHVFRNFDTNSDGTIDFREFIIALSVTSRGRLEQKLMWAFSMYDLDGNGYISREE
MLEIVQAIYKMVSSVMKMPEDESTPEKRTEKIFRQMDTNNDGKLSLEEFIRGAKSDPSIV
RLLQCDPSSASQF

Sequence of entity 2 (E), FASTA

>5M6C_2 Neuron-specific calcium-binding protein hippocalcin (chains E)
MGKQNSKLRPEMLQDLRENTEFSELELQEWYKGFLKDCPTGILNVDEFKKIYANFFPYGD
ASKFAEHVFRNFDTNSDGTIDFREFIIALSVTSRGRLEQKLMWAFSMYDLDGNGYISREE
MLEIVQAIYKMVSSVMKMPEDESTPEKRTEKIFRQMDTNNDGKLSLEEFIRGAKSDPSIV
RLLQCDPSSTSQF

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	6

Primary citation

Biophysical and functional characterization of hippocalcin mutants responsible for human dystonia. Helassa, N., Antonyuk, S.V., Lian, L.Y. et al. Hum Mol Genet (2017) 26:2426-2435. DOI 10.1093/hmg/ddx133 · PubMed

Other PDB entries of the same protein (UniProt P84074 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7OWM 1.5 Å, HsNMT1 in complex with both MyrCoA and HCPA substrate peptide GKQNSKLR
5G4P 2.42 Å, Crystal structure of human hippocalcin at 2.4 A resolution
5G58 2.54 Å, Crystal structure of A190T mutant of human hippocalcin AT 2.5 A resolution

Browse structure collections

About this viewer

MolViewer shows 5M6C directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.