5M72: Human SRP68-72 protein-binding domain complex

Structure of the human SRP68-72 protein-binding domain complex. Determined by X-ray diffraction at 1.6 Å resolution. Released 7 Dec 2016.

Method: X-ray diffraction
Resolution: 1.6 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,582
Mol. weight: 26.69 kDa
Released: 7 Dec 2016

Explore 5M72 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5M72 contains 13 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	11-23	13
α-helix	27-40	14
α-helix	45-57	13
α-helix	61-70	10
α-helix	72-75	4
α-helix	81-90	10
α-helix	94-102	9
α-helix	109-121	13
α-helix	125-138	14
α-helix	144-158	15

Chain B: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	593-597	5
α-helix	600-602	3
α-helix	604-606	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Signal recognition particle subunit SRP72	A	protein	160	Homo sapiens	O76094 (AlphaFold model)
Signal recognition particle subunit SRP68	B	protein	71	Homo sapiens	Q9UHB9 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5M72_1 Signal recognition particle subunit SRP72 (chains A)
GSVPALWSEVNRYGQNGDFTRALKTVNKILQINKDDVTALHCKVVCLIQNGSFKEALNVI
NTHTKVLANNSLSFEKAYCEYRLNRIENALKTIESANQQTDKLKELYGQVLYRLERYDEC
LAVYRDLVRNSQDDYDEERKTNLSAVVAAQSNWEKVVPGS

Sequence of entity 2 (B), FASTA

>5M72_2 Signal recognition particle subunit SRP68 (chains B)
MGSQVKDNKPLVERFETFCLDPSLVTKQANLVHFPPGFQPIPCKPLFFDLALNHVAFPPL
EDKLEQKTKSG

Primary citation

Structures of human SRP72 complexes provide insights into SRP RNA remodeling and ribosome interaction. Becker, M.M., Lapouge, K., Segnitz, B. et al. Nucleic Acids Res (2017) 45:470-481. DOI 10.1093/nar/gkw1124 · PubMed

Other PDB entries of the same protein (UniProt O76094 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5WRV 1.7 Å, Complex structure of human SRP72/SRP68
8QVX 2.7 Å, Structure of the PBD of human SRP68/72 (cryoSPARC 3DFlex)
5WRW 2.91 Å, Structure of human apo-SRP72
8QVW 3.0 Å, Cryo-EM structure of the peptide binding domain of human SRP68/72
7NFX 3.2 Å, Mammalian ribosome nascent chain complex with SRP and SRP receptor in early state A
5M73 3.4 Å, Structure of the human SRP S domain with SRP72 RNA-binding domain

Browse structure collections

About this viewer

MolViewer shows 5M72 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.