5MP3: Igh protein

Crystal structure of DC8E8 Fab in the complex with a 30-mer tau peptide at pH 6.5. Determined by X-ray diffraction at 2.75 Å resolution. Released 2 May 2018.

Method: X-ray diffraction
Resolution: 2.75 Å
Organisms: Mus musculus, Homo sapiens
Chains: 6
Atoms: 6,842
Mol. weight: 102.01 kDa
Released: 2 May 2018

Explore 5MP3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5MP3 contains 33 α-helices and 91 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	12
α-helix	7-9	3
β-strand	10-12	3	13
β-strand	18-25	8	12
α-helix	29-31	3
β-strand	33-39	7	13
β-strand	45-52	8	13
β-strand	57-60	4	13
α-helix	62-64	3
β-strand	65	1	12
β-strand	68-73	6	12
β-strand	78-83	6	12
α-helix	88-90	3
β-strand	92-99	8	13
β-strand	107-110	4	13
β-strand	114-118	5	13
α-helix	121-123	3
β-strand	124	1	14
α-helix	125-126	2
β-strand	127-131	5	15
β-strand	142-152	11	15
β-strand	153	1	14
β-strand	158-161	4	16
α-helix	162-164	3
β-strand	170-172	3	15
α-helix	173-175	3
β-strand	176-178	3	15
β-strand	181-191	11	15
β-strand	201-206	6	16
α-helix	207-209	3
β-strand	211-216	6	16

Chain B: 7 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	17
β-strand	10-14	5	18
β-strand	19-25	7	17
β-strand	30-31	2	19
β-strand	36-37	2	19
β-strand	39-44	6	18
β-strand	51-55	5	18
β-strand	59-60	2	18
α-helix	61	1
β-strand	68-73	6	17
β-strand	76-81	6	17
α-helix	86-88	3
β-strand	90-96	7	18
β-strand	102-103	2	18
β-strand	107-112	6	18
β-strand	116	1	20
α-helix	117-118	2
β-strand	119-123	5	21
α-helix	124-126	3
α-helix	127-131	5
β-strand	134-144	11	21
β-strand	145	1	20
β-strand	150-155	6	22
β-strand	158-160	3	22
β-strand	164-168	5	21
α-helix	169-172	4
β-strand	178-187	10	21
α-helix	188-191	4
β-strand	196-202	7	22
β-strand	210-215	6	22

Chain D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	303-305	3

Chain H: 9 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	1
α-helix	7-9	3
β-strand	10-12	3	2
β-strand	18-25	8	1
α-helix	29-31	3
β-strand	33-39	7	2
β-strand	45-52	8	2
β-strand	57-60	4	2
α-helix	62-64	3
β-strand	65	1	1
β-strand	68-73	6	1
β-strand	78-83	6	1
α-helix	88-90	3
β-strand	92-99	8	2
β-strand	107-110	4	2
β-strand	114-118	5	2
α-helix	122-123	2
β-strand	124	1	3
α-helix	125-126	2
β-strand	127-131	5	4
β-strand	142-152	11	4
β-strand	153	1	3
β-strand	158-161	4	5
α-helix	162-164	3
β-strand	166	1	5
β-strand	170-172	3	4
α-helix	173-175	3
β-strand	176-178	3	4
β-strand	181-191	11	4
β-strand	201-206	6	5
α-helix	207-209	3
β-strand	211-216	6	5

Chain L: 7 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	6
β-strand	10-14	5	7
β-strand	19-25	7	6
β-strand	30-31	2	8
β-strand	36-37	2	8
β-strand	39-44	6	7
β-strand	51-55	5	7
β-strand	59-60	2	7
α-helix	61	1
β-strand	68-73	6	6
β-strand	76-81	6	6
α-helix	86-88	3
β-strand	90-96	7	7
β-strand	102-103	2	7
β-strand	107-112	6	7
β-strand	116	1	9
α-helix	117-118	2
β-strand	119-123	5	10
α-helix	124-126	3
α-helix	127-132	6
β-strand	134-144	11	10
β-strand	145	1	9
β-strand	150-155	6	11
β-strand	158-160	3	11
β-strand	164-168	5	10
α-helix	169-172	4
β-strand	178-187	10	10
α-helix	188-191	4
β-strand	196-203	8	11
β-strand	206-215	10	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Igh protein	A, H	protein	220	Mus musculus	Q99LC4 (AlphaFold model)
ENSMUSG00000076577 protein	B, L	protein	218	Mus musculus	Q52L64 (AlphaFold model)
Microtubule-associated protein	C, D	protein	30	Homo sapiens	P10636 (AlphaFold model)

Sequence of entity 1 (A, H), FASTA

>5MP3_1 Igh protein (chains A, H)
QVQLQQSGPELVKPGTSVKMPCKASGYIFTDYVISWVKQRTGQGLEWIGEIFPRSGSTYY
NEKFKGKATLTADKSSNTAYMQLSSVTSEDSAVYFCARDYYGTSFAMDYWGQGTSVTVSS
AKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSD
LYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR

Sequence of entity 2 (B, L), FASTA

>5MP3_2 ENSMUSG00000076577 protein (chains B, L)
DIVMSQSPSSLAVSAGEKVTMSCKSSQSLLNSRTRKNYLAWYQQKPGQSPKLLIYWASTR
ESGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCKQSFYLRTFGGGTKLDIKRADAAPTV
SIFPPSSEQLTSGGASVVCFLNNFYPKDINVRWKIDGSERQNGVLNSWTDQDSKDSTYSM
SSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE

Sequence of entity 3 (C, D), FASTA

>5MP3_3 Microtubule-associated protein (chains C, D)
GSKDNIKHVPGGGSVQIVYKPVDLSKVTSK

Primary citation

Crystal structure of DC8E8 Fab in the complex with a 30-mer tau peptide at pH 6.5. Skrabana, R., Novak, M. To be published.

Other PDB entries of the same protein (UniProt Q99LC4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6C5K 1.75 Å, S25-23 Fab in complex with Chlamydiaceae LPS (Crystal form 2)
6C5I 1.89 Å, Unliganded S25-5 Fab
6C5H 1.99 Å, S25-5 Fab in complex with Chlamydiaceae-specific LPS antigen
6C5J 2.29 Å, S25-23 Fab in complex with Chlamydiaceae LPS (Crystal form 1)
1GIG 2.3 Å, Refined three-dimensional structure of the FAB fragment of a murine IgG1, lambda antibody
3HKF 2.5 Å, Murine unglycosylated IgG Fc fragment
1JHK 2.51 Å, Crystal structure of the anti-estradiol antibody 57-2
2A1W 2.7 Å, Anti-cocaine antibody 7.5.21, crystal form I
4Q0X 2.9 Å, Crystal structure of non-neutralizing antibody in complex with Epitope II of HCV E2
1JNL 3.0 Å, Crystal Structure of Fab-Estradiol Complexes
1JNN 3.2 Å, Crystal Structure of Fab-Estradiol Complexes
1AFV 3.7 Å, HIV-1 capsid protein (P24) complex with FAB25.3

Browse structure collections

About this viewer

MolViewer shows 5MP3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.