5MQG: CREBBP bromodomain

Crystal structure of CREBBP bromodomain complexed with CBP015. Determined by X-ray diffraction at 1.35 Å resolution. Released 19 Apr 2017.

Method: X-ray diffraction
Resolution: 1.35 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,283
Mol. weight: 28.78 kDa
Ligands: F31
Released: 19 Apr 2017

Explore 5MQG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5MQG contains 13 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	1087-1102	16
α-helix	1109-1111	3
α-helix	1117-1120	4
α-helix	1125-1128	4
α-helix	1135-1143	9
α-helix	1150-1167	18
α-helix	1173-1195	23

Chain B: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	1087-1102	16
α-helix	1109-1111	3
α-helix	1125-1128	4
α-helix	1135-1143	9
α-helix	1150-1167	18
α-helix	1173-1194	22

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
CREB-binding protein	A, B	protein	119	Homo sapiens	Q92793 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5MQG_1 CREB-binding protein (chains A, B)
SMRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTI
KRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLG

Ligands and cofactors

ID	Name	Formula	Copies
F31	1-(4-azanyl-3-methoxy-phenyl)ethanone	C9 H11 N O2	2

Primary citation

Virtual screen to NMR (VS2NMR): Discovery of fragment hits for the CBP bromodomain. Spiliotopoulos, D., Zhu, J., Wamhoff, E.C. et al. Bioorg Med Chem Lett (2017) 27:2472-2478. DOI 10.1016/j.bmcl.2017.04.001 · PubMed

Other PDB entries of the same protein (UniProt Q92793 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5I86 1.05 Å, Crystal structure of the bromodomain of human CREBBP bound to the benzodiazepinone…
5J0D 1.05 Å, Crystal structure of the bromodomain of human CREBBP in complex with a benzoxazepine…
5I89 1.07 Å, Crystal structure of the bromodomain of human CREBBP bound to the benzodiazepinone…
5KTW 1.09 Å, CREBBP bromodomain in complex with Cpd 44 (3-((5-acetyl-1-(cyclopropylmethyl)-4,5,6,7-tet…
4NYX 1.1 Å, Crystal Structure of the Bromodomain of human CREBBP in complex with a…
5EP7 1.2 Å, Crystal structure of the bromodomain of human CREBBP in complex with UN32
4NR7 1.2 Å, Crystal structure of the bromodomain of human CREBBP in complex with an…
6YIL 1.22 Å, Crystal structure of the CREBBP bromodomain in complex with a tetrahydroquinoxaline ligand
5MMG 1.23 Å, Crystal structure of CREBBP bromodomain complexed with UT07C
5MPN 1.23 Å, Crystal structure of CREBBP bromodomain complexed with FA26
6YIM 1.23 Å, Crystal structure of the CREBBP bromodomain in complex with a benzo-diazepine ligand
7WX2 1.24 Å, CBP-BrD complexed with NEO2734

Browse structure collections

About this viewer

MolViewer shows 5MQG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.