5MVV: Actin-1

Crystal structure of Plasmodium falciparum actin I- gelsolin segment 1 -CdATP complex. Determined by X-ray diffraction at 1.4 Å resolution. Released 12 Jul 2017.

Method: X-ray diffraction
Resolution: 1.4 Å
Organisms: Plasmodium falciparum (isolate 3D7), Mus musculus
Chains: 2
Atoms: 4,781
Mol. weight: 57.24 kDa
Ligands: ATP, SCN, CD, CA
Released: 12 Jul 2017

Explore 5MVV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5MVV contains 29 α-helices and 26 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 23 helices, 19 β-strands

Element	Residues	Length	Sheet
α-helix	7-8	2
β-strand	9-13	5	1
β-strand	17-22	6	1
β-strand	30-33	4	1
β-strand	36-39	4	2
β-strand	54-55	2	2
α-helix	57-61	5
β-strand	66-69	4	2
β-strand	72-73	2	3
β-strand	76-77	2	3
α-helix	80-88	9
α-helix	89-95	7
α-helix	99-101	3
β-strand	104-108	5	1
α-helix	114-122	9
α-helix	123-127	5
β-strand	132-137	6	1
α-helix	138-145	8
β-strand	151-156	6	4
β-strand	161-167	7	4
β-strand	170-171	2	4
α-helix	173-175	3
β-strand	177-179	3	4
α-helix	183-193	11
α-helix	194-197	4
α-helix	204-217	14
α-helix	224-232	9
β-strand	239-242	4	5
β-strand	248-251	4	5
α-helix	254-260	7
α-helix	265-268	4
α-helix	275-284	10
α-helix	291-295	5
β-strand	298-301	4	4
α-helix	303-305	3
α-helix	310-321	12
β-strand	330-331	2	4
α-helix	336-338	3
α-helix	339-349	11
α-helix	353-355	3
β-strand	358-359	2	1
α-helix	360-365	6

Chain G: 6 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	30-34	5
β-strand	40-47	8	6
β-strand	50-53	4	6
α-helix	54-55	2
α-helix	56-58	3
β-strand	61-63	3	7
β-strand	67-75	9	6
β-strand	81-89	9	6
α-helix	95-111	17
β-strand	117-122	6	6
α-helix	128-131	4
β-strand	139-141	3	7
α-helix	145-147	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Actin-1	A	protein	378	Plasmodium falciparum (isolate 3D7)	Q8I4X0 (AlphaFold model)
Gelsolin	G	protein	127	Mus musculus	P13020 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5MVV_1 Actin-1 (chains A)
GAMGEEDVQALVVDNGSGNVKAGVAGDDAPRSVFPSIVGRPKNPGIMVGMEEKDAFVGDE
AQTKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRAAPEEHPVLLTEAPLNPKGNRE
RMTQIMFESFNVPAMYVAIQAVLSLYSSGRTTGIVLDSGDGVSHTVPIYEGYALPHAIMR
LDLAGRDLTEYLMKILHERGYGFSTSAEKEIVRDIKEKLCYIALNFDEEMKTSEQSSDIE
KSYELPDGNIITVGNERFRCPEALFQPSFLGKEAAGIHTTTFNSIKKCDVDIRKDLYGNI
VLSGGTTMYEGIGERLTRDITTLAPSTMKIKVVAPPERKYSVWIGGSILSSLSTFQQMWI
TKEEYDESGPSIVHRKCF

Sequence of entity 2 (G), FASTA

>5MVV_2 Gelsolin (chains G)
GPMVVEHPEFLKAGKEPGLQIWRVEKFDLVPVPPNLYGDFFTGDAYVILKTVQLRNGNLQ
YDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESSTFSGYFKSGLKYKK
GGVASGF

Ligands and cofactors

ID	Name	Formula	Copies
ATP	Adenosine-5'-triphosphate	C10 H16 N5 O13 P3	1
SCN	Thiocyanate ion	C N S	1
CD	Cadmium ion	Cd	3
CA	Calcium ion	Ca	2

Primary citation

Rapid cadmium SAD phasing at the standard wavelength (1 angstrom ). Panneerselvam, S., Kumpula, E.P., Kursula, I. et al. Acta Crystallogr D Struct Biol (2017) 73:581-590. DOI 10.1107/S2059798317006970 · PubMed

Other PDB entries of the same protein (UniProt Q8I4X0 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6I4E 1.22 Å, Crystal Structure of Plasmodium falciparum actin I in the Mg-ADP state
6I4D 1.24 Å, Crystal Structure of Plasmodium falciparum actin I in the Mg-K-ATP/ADP state
4CBU 1.3 Å, Crystal structure of Plasmodium falciparum actin I
6I4H 1.4 Å, Crystal Structure of Plasmodium falciparum actin I (F54Y mutant) in the Ca-ATP state
6I4F 1.5 Å, Crystal Structure of Plasmodium falciparum actin I (A272W mutant) in the Mg-K-ATP/ADP…
6I4J 1.5 Å, Crystal Structure of Plasmodium falciparum actin I (F54Y mutant) in the Mg-ADP state
6I4K 1.83 Å, Crystal Structure of Plasmodium falciparum actin I (G115A mutant) in the Ca-ATP state
6I4L 1.83 Å, Crystal Structure of Plasmodium falciparum actin I (G115A mutant) in the Mg-K-ATP/ADP…
6I4I 1.9 Å, Crystal Structure of Plasmodium falciparum actin I (F54Y mutant) in the Mg-K-ADP-AlFn…
6I4G 2.0 Å, Crystal Structure of Plasmodium falciparum actin I (H74Q) in the Mg-K-ATP state
6TU4 2.6 Å, Structure of Plasmodium Actin1 filament
6TU7 3.1 Å, Structure of PfMyoA decorated Plasmodium Act1 filament

Browse structure collections

About this viewer

MolViewer shows 5MVV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.