6I4K: Actin-1

Crystal Structure of Plasmodium falciparum actin I (G115A mutant) in the Ca-ATP state. Determined by X-ray diffraction at 1.83 Å resolution. Released 26 Jun 2019.

Method: X-ray diffraction
Resolution: 1.83 Å
Organisms: Plasmodium falciparum, Mus musculus
Chains: 2
Atoms: 4,710
Mol. weight: 57.45 kDa
Ligands: BTB, SCN, CA, ATP
Released: 26 Jun 2019

Explore 6I4K in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6I4K contains 31 α-helices and 26 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 25 helices, 19 β-strands

Element	Residues	Length	Sheet
α-helix	7-8	2
β-strand	9-13	5	1
β-strand	17-22	6	1
β-strand	30-33	4	1
β-strand	36-39	4	2
β-strand	54-55	2	2
α-helix	57-61	5
β-strand	66-69	4	2
β-strand	72-73	2	3
β-strand	76-77	2	3
α-helix	80-88	9
α-helix	89-95	7
α-helix	99-101	3
β-strand	104-108	5	1
α-helix	114-122	9
α-helix	123-127	5
β-strand	132-137	6	1
α-helix	138-145	8
β-strand	151-156	6	4
β-strand	161-167	7	4
β-strand	170-171	2	4
α-helix	173-175	3
β-strand	177-179	3	4
α-helix	183-193	11
α-helix	194-197	4
α-helix	204-217	14
α-helix	224-232	9
β-strand	239-242	4	5
β-strand	248-251	4	5
α-helix	254-260	7
α-helix	265-268	4
α-helix	275-284	10
α-helix	288-290	3
α-helix	291-295	5
β-strand	298-301	4	4
α-helix	303-305	3
α-helix	310-321	12
β-strand	330-331	2	4
α-helix	336-338	3
α-helix	339-347	9
α-helix	351-355	5
β-strand	358-359	2	1
α-helix	360-366	7
α-helix	370-374	5

Chain G: 6 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	6-10	5
β-strand	16-23	8	6
β-strand	26-29	4	6
α-helix	30-31	2
α-helix	32-34	3
β-strand	37-39	3	7
β-strand	43-51	9	6
β-strand	57-65	9	6
α-helix	71-87	17
β-strand	93-98	6	6
α-helix	104-107	4
β-strand	115-117	3	7
α-helix	121-123	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Actin-1	A	protein	378	Plasmodium falciparum	Q8I4X0 (AlphaFold model)
Gelsolin	G	protein	127	Mus musculus	P13020 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6I4K_1 Actin-1 (chains A)
GAMGEEDVQALVVDNGSGNVKAGVAGDDAPRSVFPSIVGRPKNPGIMVGMEEKDAFVGDE
AQTKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRAAPEEHPVLLTEAPLNPKANRE
RMTQIMFESFNVPAMYVAIQAVLSLYSSGRTTGIVLDSGDGVSHTVPIYEGYALPHAIMR
LDLAGRDLTEYLMKILHERGYGFSTSAEKEIVRDIKEKLCYIALNFDEEMKTSEQSSDIE
KSYELPDGNIITVGNERFRCPEALFQPSFLGKEAAGIHTTTFNSIKKCDVDIRKDLYGNI
VLSGGTTMYEGIGERLTRDITTLAPSTMKIKVVAPPERKYSVWIGGSILSSLSTFQQMWI
TKEEYDESGPSIVHRKCF

Sequence of entity 2 (G), FASTA

>6I4K_2 Gelsolin (chains G)
GPMVVEHPEFLKAGKEPGLQIWRVEKFDLVPVPPNLYGDFFTGDAYVILKTVQLRNGNLQ
YDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESSTFSGYFKSGLKYKK
GGVASGF

Ligands and cofactors

ID	Name	Formula	Copies
BTB	2-[bis-(2-hydroxy-ethyl)-amino]-2-hydroxymethyl-propane-1,3-diol	C8 H19 N O5	1
SCN	Thiocyanate ion	C N S	2
CA	Calcium ion	Ca	3
ATP	Adenosine-5'-triphosphate	C10 H16 N5 O13 P3	1

Water and common crystallization additives (BME, CL, PEG) are not listed.

Primary citation

Atomic view into Plasmodium actin polymerization, ATP hydrolysis, and fragmentation. Kumpula, E.P., Lopez, A.J., Tajedin, L. et al. PLoS Biol (2019) 17:e3000315-e3000315. DOI 10.1371/journal.pbio.3000315 · PubMed

Other PDB entries of the same protein (UniProt Q8I4X0 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6I4E 1.22 Å, Crystal Structure of Plasmodium falciparum actin I in the Mg-ADP state
6I4D 1.24 Å, Crystal Structure of Plasmodium falciparum actin I in the Mg-K-ATP/ADP state
4CBU 1.3 Å, Crystal structure of Plasmodium falciparum actin I
5MVV 1.4 Å, Crystal structure of Plasmodium falciparum actin I- gelsolin segment 1 -CdATP complex
6I4H 1.4 Å, Crystal Structure of Plasmodium falciparum actin I (F54Y mutant) in the Ca-ATP state
6I4F 1.5 Å, Crystal Structure of Plasmodium falciparum actin I (A272W mutant) in the Mg-K-ATP/ADP…
6I4J 1.5 Å, Crystal Structure of Plasmodium falciparum actin I (F54Y mutant) in the Mg-ADP state
6I4L 1.83 Å, Crystal Structure of Plasmodium falciparum actin I (G115A mutant) in the Mg-K-ATP/ADP…
6I4I 1.9 Å, Crystal Structure of Plasmodium falciparum actin I (F54Y mutant) in the Mg-K-ADP-AlFn…
6I4G 2.0 Å, Crystal Structure of Plasmodium falciparum actin I (H74Q) in the Mg-K-ATP state
6TU4 2.6 Å, Structure of Plasmodium Actin1 filament
6TU7 3.1 Å, Structure of PfMyoA decorated Plasmodium Act1 filament

Browse structure collections

About this viewer

MolViewer shows 6I4K directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.