5N6R: Dbl-homology domain of Bcr-Abl

Solution structure of the Dbl-homology domain of Bcr-Abl. Determined by solution NMR. Released 27 Dec 2017.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 1,744
Mol. weight: 24.84 kDa
Released: 27 Dec 2017

Explore 5N6R in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5N6R contains 10 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	489-530	42
α-helix	540-544	5
α-helix	550-562	13
α-helix	564-568	5
α-helix	579-586	8
α-helix	589-595	7
α-helix	598-611	14
α-helix	613-620	8
α-helix	639-663	25
α-helix	670-686	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Breakpoint cluster region protein	A	protein	218	Homo sapiens	P11274 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5N6R_1 Breakpoint cluster region protein (chains A)
AMASELDLEKGLEMRKWVLSGILASEETYLSHLEALLLPMKPLKAAATTSQPVLTSQQIE
TIFFKVPELYEIHKEFYDGLFPRVQQWSHQQRVGDLFQKLASQLGVYRAFVDNYGVAMEM
AEKCCQANAQFAEISENLRARSNKDAKDPTTKNSLETLLYKPVDRVTRSTLVLHDLLKHT
PASHPDHPLLQDALRISQNFLSSINEEITPRRQSMTVK

Primary citation

Structural and functional dissection of the DH and PH domains of oncogenic Bcr-Abl tyrosine kinase. Reckel, S., Gehin, C., Tardivon, D. et al. Nat Commun (2017) 8:2101-2101. DOI 10.1038/s41467-017-02313-6 · PubMed

Other PDB entries of the same protein (UniProt P11274 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5N7E 1.65 Å, Crystal structure of the Dbl-homology domain of Bcr-Abl in complex with monobody…
5OC7 1.65 Å, Crystal structure of the pleckstrin-homology domain of Bcr-Abl in complex with monobody…
1K1F 2.2 Å, Structure of the Bcr-Abl Oncoprotein Oligomerization domain
2AIN Solution structure of the AF-6 PDZ domain complexed with the C-terminal peptide from the…

Browse structure collections

About this viewer

MolViewer shows 5N6R directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.