5NUV: WD40-domain of human ATG16L1

Structure of the WD40-domain of human ATG16L1. Determined by X-ray diffraction at 1.55 Å resolution. Released 19 Jul 2017.

Method: X-ray diffraction
Resolution: 1.55 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,542
Mol. weight: 33.58 kDa
Ligands: BU3
Released: 19 Jul 2017

Explore 5NUV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5NUV contains 0 α-helices and 28 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 0 helices, 28 β-strands

Element	Residues	Length	Sheet
β-strand	313-319	7	1
β-strand	325-330	6	2
β-strand	336-341	6	2
β-strand	346-351	6	2
β-strand	356-362	7	2
β-strand	369-374	6	3
β-strand	380-385	6	3
β-strand	390-394	5	3
β-strand	399-404	6	3
β-strand	411-416	6	4
β-strand	422-427	6	4
β-strand	431-436	6	4
β-strand	441-447	7	4
β-strand	452-457	6	5
β-strand	461-466	6	5
β-strand	470-475	6	5
β-strand	480-486	7	5
β-strand	491-496	6	6
β-strand	502-507	6	6
β-strand	511-516	6	6
β-strand	521-526	6	6
β-strand	540-542	3	7
β-strand	548-552	5	7
β-strand	558-562	5	7
β-strand	568-572	5	7
β-strand	580-585	6	1
β-strand	592-596	5	1
β-strand	600-605	6	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Autophagy-related protein 16-1	A	protein	309	Homo sapiens	Q676U5 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5NUV_1 Autophagy-related protein 16-1 (chains A)
GGGRGSGKEVRVPATALCVFDAHDGEVNAVQFSPGSRLLATGGMDRRVKLWEVFGAACEF
KGSLSGSNAGITSIEFDSAGSYLLAASNDFASRIWTVDDYRLRHTLTGHSGKVLSAKFLL
DNARIVSGSHDRTLKLWDLRSKVCIKTVFAGSSCNDIVCTEQCVMSGHFDKKIRFWDIRS
ESIVREMELLGKITALDLNPERTELLSCSRDDLLKVIDLRTNAIKQTFSAPGFKCGSDWT
RVVFSPDGSYVAAGSAEGSLYIWSVLTGKVEKVLSKQHSSSINAVAWSPSGSHVVSVDKG
CKAVLWAQP

Ligands and cofactors

ID	Name	Formula	Copies
BU3	(r,r)-2,3-butanediol	C4 H10 O2	1

Primary citation

Structure of the WD40-domain of human ATG16L1. Bajagic, M., Archna, A., Busing, P. et al. Protein Sci (2017) 26:1828-1837. DOI 10.1002/pro.3222 · PubMed

Other PDB entries of the same protein (UniProt Q676U5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7F69 1.5 Å, Crystal structure of WIPI2b in complex with ATG16L1
7XFR 1.76 Å, Crystal structure of WIPI2b in complex with the second site of ATG16L1
9JF2 1.76 Å, Crystal structure of GABARAPL1 in complex with ATG16L1
4NAW 2.19 Å, Crystal Structure of Human ATG12~ATG5-ATG16N in complex with a fragment of ATG3
4TQ0 2.7 Å, Crystal structure of human ATG5-ATG16N69
4GDK 2.7 Å, Crystal Structure of Human Atg12~Atg5 Conjugate in Complex with an N-terminal Fragment…
8ZQG 2.77 Å, Crystal structure of WIPI3 in complex with ATG16L1
4GDL 2.88 Å, Crystal Structure of Human Atg12~Atg5 Conjugate in Complex with an N-terminal Fragment…
5D7G 3.0 Å, Structure of human ATG5 E122D-ATG16L1 complex at 3.0 Angstroms
7W36 3.0 Å, Crystal structure of human Atg5 complexed with a stapled peptide
5NPV 3.1 Å, Structure of human ATG5-ATG16L1(ATG5BD) complex (I4)
5NPW 3.1 Å, Structure of human ATG5-ATG16L1(ATG5BD) complex (C2)

Browse structure collections

About this viewer

MolViewer shows 5NUV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.