Crystal Structure of Human Pro-myostatin Precursor at 4.2 A Resolution with Experimental Phases from SeMet labelling. Determined by X-ray diffraction at 4.19 Å resolution. Released 17 Jan 2018.
Explore 5NXS in 3D Show helices and sheets RCSB PDB PDBe
5NXS contains 12 α-helices and 35 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 44-63 | 20 | |
| α-helix | 74-80 | 7 | |
| α-helix | 85-91 | 7 | |
| β-strand | 114-120 | 7 | 1 |
| β-strand | 122-123 | 2 | 2 |
| β-strand | 139-140 | 2 | 2 |
| β-strand | 151-160 | 10 | 1 |
| α-helix | 161-163 | 3 | |
| β-strand | 169-175 | 7 | 3 |
| β-strand | 187-194 | 8 | 3 |
| β-strand | 202-207 | 6 | 1 |
| α-helix | 209-217 | 9 | |
| α-helix | 219-221 | 3 | |
| β-strand | 225-231 | 7 | 3 |
| β-strand | 236 | 1 | 3 |
| β-strand | 238 | 1 | 1 |
| β-strand | 252-257 | 6 | 1 |
| β-strand | 284 | 1 | 4 |
| β-strand | 287-289 | 3 | 5 |
| β-strand | 300 | 1 | 6 |
| β-strand | 303-305 | 3 | 5 |
| β-strand | 308 | 1 | 4 |
| β-strand | 340-353 | 14 | 6 |
| β-strand | 359-374 | 16 | 6 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 45-63 | 19 | |
| α-helix | 74-80 | 7 | |
| α-helix | 85-91 | 7 | |
| β-strand | 115-120 | 6 | 6 |
| β-strand | 151-157 | 7 | 6 |
| α-helix | 159 | 1 | |
| β-strand | 160 | 1 | 7 |
| α-helix | 161-163 | 3 | |
| β-strand | 169-174 | 6 | 8 |
| β-strand | 189-194 | 6 | 8 |
| β-strand | 205-207 | 3 | 6 |
| α-helix | 209-217 | 9 | |
| β-strand | 226-230 | 5 | 8 |
| β-strand | 236 | 1 | 8 |
| β-strand | 238 | 1 | 7 |
| β-strand | 252-257 | 6 | 6 |
| β-strand | 281-284 | 4 | 9 |
| β-strand | 287-289 | 3 | 10 |
| β-strand | 300 | 1 | 1 |
| β-strand | 303-305 | 3 | 10 |
| β-strand | 308-311 | 4 | 9 |
| β-strand | 340-352 | 13 | 1 |
| β-strand | 358-374 | 17 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Growth/differentiation factor 8 | A, B | protein | 335 | Homo sapiens | O14793 (AlphaFold model) |
>5NXS_1 Growth/differentiation factor 8 (chains A, B) GSTWRQNTKSSRIEAIKIQILSKLRLETAPNISKDVIRQLLPKAPPLRELIDQYDVQRDD SSDGSLEDDDYHATTETIITMPTESDFLMQVDGKPKCCFFKFSSKIQYNKVVKAQLWIYL RPVETPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQPE SNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESR CCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCC TPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS
Structure of the human myostatin precursor and determinants of growth factor latency. Cotton, T.R., Fischer, G., Wang, X. et al. EMBO J (2018) 37:367-383. DOI 10.15252/embj.201797883 · PubMed
Other PDB entries of the same protein (UniProt O14793 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5NXS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.