5O8K: Mammalian Rev7

Crystal structure of mammalian Rev7 in complex with Rev3 1875-1895. Determined by X-ray diffraction at 1.8 Å resolution. Released 27 Jun 2018.

Method: X-ray diffraction
Resolution: 1.8 Å
Organisms: Mus musculus, Homo sapiens
Chains: 2
Atoms: 1,851
Mol. weight: 27.62 kDa
Released: 27 Jun 2018

Explore 5O8K in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5O8K contains 10 α-helices and 9 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	11-33	23
α-helix	39-41	3
β-strand	42-47	6	1
β-strand	50-55	6	1
α-helix	58-76	19
β-strand	80-88	9	2
β-strand	94-103	10	2
α-helix	105	1
α-helix	107	1
α-helix	114-130	17
α-helix	133-135	3
α-helix	138-141	4
β-strand	145-152	8	2
β-strand	171-173	3	2
β-strand	185-192	8	2
β-strand	198-205	8	2

Chain B: 2 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	1877-1880	4	2
α-helix	1883-1886	4
α-helix	1887-1894	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mitotic spindle assembly checkpoint protein MAD2B	A	protein	211	Mus musculus	Q9D752 (AlphaFold model)
DNA polymerase zeta catalytic subunit	B	protein	28	Homo sapiens	O60673

Sequence of entity 1 (A), FASTA

>5O8K_1 Mitotic spindle assembly checkpoint protein MAD2B (chains A)
MTTLTRQDLNSAQVVADVLSEFLEVAVHLILYVREVYPVGIFQKRKKYNVPVQMSCHPEL
NQYIQDTLHCVKPLLEKNDVEKVVVVILDKEHRPVEKFVFEITQPPLLSINSDSLLSHVE
QLLRAFILKISKVDKVLDHNPPGCTFTVLVHTREAATRNMEKIQVIKDFPWILADEQDVH
MHDPRLIPLKTMTSDILKMQLYVEERAHKNS

Sequence of entity 2 (B), FASTA

>5O8K_2 DNA polymerase zeta catalytic subunit (chains B)
MGRTANILKPLMSPPSREEIMATLLDHD

Primary citation

Crystal structure of mammalian Rev7 in complex with Rev3 1875-1895. Emamzadah, S., Tropia, L., Huber, F. et al. To be published.

Other PDB entries of the same protein (UniProt Q9D752 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6EKJ 1.6 Å, Crystal structure of mammalian Rev7 in complex with human Chromosome…
6EKL 1.6 Å, Crystal structure of mammalian Rev7 in complex with human Chromosome…
4FJO 2.72 Å, Structure of the Rev1 CTD-Rev3/7-Pol kappa RIR complex
6EKM 2.76 Å, Crystal structure of mammalian Rev7 in complex with human Rev3 second binding site

Browse structure collections

About this viewer

MolViewer shows 5O8K directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.