6EKL: Mammalian Rev7

Crystal structure of mammalian Rev7 in complex with human Chromosome alignment-maintaining phosphoprotein 1. Determined by X-ray diffraction at 1.6 Å resolution. Released 10 Oct 2018.

Method: X-ray diffraction
Resolution: 1.6 Å
Organisms: Mus musculus, Homo sapiens
Chains: 2
Atoms: 1,834
Mol. weight: 27.41 kDa
Released: 10 Oct 2018

Explore 6EKL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6EKL contains 9 α-helices and 10 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	6-8	3
α-helix	10-33	24
α-helix	39-41	3
β-strand	42-47	6	1
β-strand	50-55	6	1
α-helix	58-69	12
α-helix	72-77	6
β-strand	80-88	9	2
β-strand	94-103	10	2
α-helix	119-131	13
α-helix	133-135	3
α-helix	138-141	4
β-strand	145-152	8	2
β-strand	163-166	4	2
β-strand	169-173	5	2
β-strand	185-193	9	2
β-strand	198-205	8	2

Chain B: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
β-strand	331-336	6	2
α-helix	339-342	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mitotic spindle assembly checkpoint protein MAD2B	A	protein	211	Mus musculus	Q9D752 (AlphaFold model)
Chromosome alignment-maintaining phosphoprotein 1	B	protein	29	Homo sapiens	Q96JM3 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>6EKL_1 Mitotic spindle assembly checkpoint protein MAD2B (chains A)
MTTLTRQDLNSAQVVADVLSEFLEVAVHLILYVREVYPVGIFQKRKKYNVPVQMSCHPEL
NQYIQDTLHCVKPLLEKNDVEKVVVVILDKEHRPVEKFVFEITQPPLLSINSDSLLSHVE
QLLRAFILKISKVDKVLDHNPPGCTFTVLVHTREAATRNMEKIQVIKDFPWILADEQDVH
MHDPRLIPLKTMTSDILKMQLYVEERAHKNS

Sequence of entity 2 (B), FASTA

>6EKL_2 Chromosome alignment-maintaining phosphoprotein 1 (chains B)
MSASSGPWKPAKPAPSVSPGPWKPIPSVS

Primary citation

Crystal structure of mammalian Rev7 in complex with Champ1. Huber, F., Tropia, L., Emamzadah, S. et al. To be published.

Other PDB entries of the same protein (UniProt Q9D752 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6EKJ 1.6 Å, Crystal structure of mammalian Rev7 in complex with human Chromosome…
5O8K 1.8 Å, Crystal structure of mammalian Rev7 in complex with Rev3 1875-1895
4FJO 2.72 Å, Structure of the Rev1 CTD-Rev3/7-Pol kappa RIR complex
6EKM 2.76 Å, Crystal structure of mammalian Rev7 in complex with human Rev3 second binding site

Browse structure collections

About this viewer

MolViewer shows 6EKL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.