6EKM: Mammalian Rev7

Crystal structure of mammalian Rev7 in complex with human Rev3 second binding site. Determined by X-ray diffraction at 2.76 Å resolution. Released 10 Oct 2018.

Method: X-ray diffraction
Resolution: 2.76 Å
Organisms: Mus musculus, Homo sapiens
Chains: 2
Atoms: 1,839
Mol. weight: 27.68 kDa
Released: 10 Oct 2018

Explore 6EKM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6EKM contains 11 α-helices and 9 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	11-33	23
α-helix	39-41	3
β-strand	42-47	6	1
β-strand	50-55	6	1
α-helix	58-76	19
β-strand	82-88	7	2
β-strand	94-103	10	2
α-helix	117-132	16
α-helix	133-135	3
α-helix	138-141	4
β-strand	145-153	9	2
α-helix	158-166	9
β-strand	171-173	3	2
α-helix	174-175	2
α-helix	176-179	4
β-strand	185-192	8	2
β-strand	198-205	8	2

Chain B: 2 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	1991-1996	6	2
α-helix	1999-2002	4
α-helix	2003-2011	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mitotic spindle assembly checkpoint protein MAD2B	A	protein	211	Mus musculus	Q9D752 (AlphaFold model)
DNA polymerase zeta catalytic subunit	B	protein	28	Homo sapiens	O60673

Sequence of entity 1 (A), FASTA

>6EKM_1 Mitotic spindle assembly checkpoint protein MAD2B (chains A)
MTTLTRQDLNSAQVVADVLSEFLEVAVHLILYVREVYPVGIFQKRKKYNVPVQMSCHPEL
NQYIQDTLHCVKPLLEKNDVEKVVVVILDKEHRPVEKFVFEITQPPLLSINSDSLLSHVE
QLLRAFILKISKVDKVLDHNPPGCTFTVLVHTREAATRNMEKIQVIKDFPWILADEQDVH
MHDPRLIPLKTMTSDILKMQLYVEERAHKNS

Sequence of entity 2 (B), FASTA

>6EKM_2 DNA polymerase zeta catalytic subunit (chains B)
MGDKKIVIMPCKCAPSRQLVQVWLQAKE

Primary citation

Crystal structure of mammalian Rev7 in complex with human Rev3. Huber, F., Tropia, L., Emamzadah, S. et al. To be published.

Other PDB entries of the same protein (UniProt Q9D752 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6EKJ 1.6 Å, Crystal structure of mammalian Rev7 in complex with human Chromosome…
6EKL 1.6 Å, Crystal structure of mammalian Rev7 in complex with human Chromosome…
5O8K 1.8 Å, Crystal structure of mammalian Rev7 in complex with Rev3 1875-1895
4FJO 2.72 Å, Structure of the Rev1 CTD-Rev3/7-Pol kappa RIR complex

Browse structure collections

About this viewer

MolViewer shows 6EKM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.