5OC7: Pleckstrin-homology domain of Bcr-Abl

Crystal structure of the pleckstrin-homology domain of Bcr-Abl in complex with monobody Mb(Bcr-PH_4). Determined by X-ray diffraction at 1.65 Å resolution. Released 27 Dec 2017.

Method: X-ray diffraction
Resolution: 1.65 Å
Organisms: Homo sapiens, synthetic construct
Chains: 4
Atoms: 3,599
Mol. weight: 51.54 kDa
Ligands: IP2
Released: 27 Dec 2017

Explore 5OC7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5OC7 contains 12 α-helices and 30 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	709-719	11	2
β-strand	722-731	10	2
β-strand	734-739	6	2
β-strand	752-758	7	2
α-helix	759-761	3
β-strand	762-767	6	2
β-strand	833-838	6	2
β-strand	843-847	5	2
α-helix	851-865	15
α-helix	876-885	10

Chain B: 3 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	8-15	8	5
β-strand	19-25	7	5
β-strand	33-40	8	6
α-helix	46-47	2
β-strand	48-53	6	6
β-strand	58-62	5	5
α-helix	64-65	2
β-strand	69-78	10	6
β-strand	81-82	2	6
α-helix	83-85	3
β-strand	86-91	6	6

Chain C: 3 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	8-16	9	3
β-strand	19-25	7	3
β-strand	33-40	8	4
α-helix	45-47	3
β-strand	48-53	6	4
β-strand	58-61	4	3
α-helix	64-65	2
β-strand	69-78	10	4
β-strand	81-82	2	4
α-helix	83-85	3
β-strand	86-91	6	4

Chain D: 3 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	709-719	11	1
β-strand	722-731	10	1
β-strand	734-740	7	1
β-strand	751-758	8	1
α-helix	759-761	3
β-strand	762-767	6	1
β-strand	833-838	6	1
β-strand	843-847	5	1
α-helix	851-865	15
α-helix	876-885	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Breakpoint cluster region protein,pleckstrin-homology domain of Bcr-Abl	A, D	protein	133	Homo sapiens	P11274 (AlphaFold model)
monobody Mb(Bcr-PH_4)	B, C	protein	92	synthetic construct

Sequence of entity 1 (A, D), FASTA

>5OC7_1 Breakpoint cluster region protein,pleckstrin-homology domain of Bcr-Abl (chains A, D)
GAMGEHRQLLKDSFMVELVEGARKLRHVFLFTDLLLCTKLKKQSGGKTQQYDCKWYIPLT
DLSFQMVDEPSMAFRVHSRNGKSYTFLISSDYERAEWRENIREQQKKCFRSFSLTSVELQ
MLTNSCVKLQTVH

Sequence of entity 2 (B, C), FASTA

>5OC7_2 monobody Mb(Bcr-PH_4) (chains B, C)
GSVSSVPTKLEVVAATPTSLLISWDAPAVTVVFYVITYGETGGNSPVQEFTVPGSKSTAT
ISGLKPGVDYTITVYAEYYGMTGSPISINYRT

Ligands and cofactors

ID	Name	Formula	Copies
IP2	D-myo-inositol-4,5-bisphosphate	C6 H14 O12 P2	1

Water and common crystallization additives (GOL) are not listed.

Primary citation

Structural and functional dissection of the DH and PH domains of oncogenic Bcr-Abl tyrosine kinase. Reckel, S., Gehin, C., Tardivon, D. et al. Nat Commun (2017) 8:2101-2101. DOI 10.1038/s41467-017-02313-6 · PubMed

Other PDB entries of the same protein (UniProt P11274 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5N7E 1.65 Å, Crystal structure of the Dbl-homology domain of Bcr-Abl in complex with monobody…
1K1F 2.2 Å, Structure of the Bcr-Abl Oncoprotein Oligomerization domain
2AIN Solution structure of the AF-6 PDZ domain complexed with the C-terminal peptide from the…
5N6R Solution structure of the Dbl-homology domain of Bcr-Abl

Browse structure collections

About this viewer

MolViewer shows 5OC7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.