5OHQ: KOW6-KOW7 domain of human DSIF

Crystal structure of the KOW6-KOW7 domain of human DSIF. Determined by X-ray diffraction at 1.1 Å resolution. Released 13 Sept 2017.

Method: X-ray diffraction
Resolution: 1.1 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,226
Mol. weight: 12.27 kDa
Released: 13 Sept 2017

Explore 5OHQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5OHQ contains 3 α-helices and 12 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	984	1	1
β-strand	985-988	4	2
β-strand	1001-1008	8	2
β-strand	1011-1016	6	2
β-strand	1021-1026	6	2
α-helix	1027-1029	3
β-strand	1030-1032	3	2
α-helix	1033-1035	3
β-strand	1040-1043	4	3
β-strand	1052-1059	8	3
β-strand	1062-1067	6	3
β-strand	1073-1077	5	3
α-helix	1078-1080	3
β-strand	1081-1083	3	3
β-strand	1084	1	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transcription elongation factor SPT5	A	protein	111	Homo sapiens	O00267 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5OHQ_1 Transcription elongation factor SPT5 (chains A)
GPWVTTDIQVKVRDTYLDTQVVGQTGVIRSVTGGMCSVYLKDSEKVVSISSEHLEPITPT
KNNKVKVILGEDREATGVLLSIDGEDGIVRMDLDEQLKILNLRFLGKLLEA

Primary citation

Structure of a transcribing RNA polymerase II-DSIF complex reveals a multidentate DNA-RNA clamp. Bernecky, C., Plitzko, J.M., Cramer, P. Nat Struct Mol Biol (2017) 24:809-815. DOI 10.1038/nsmb.3465 · PubMed

Other PDB entries of the same protein (UniProt O00267 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3H7H 1.55 Å, Crystal structure of the human transcription elongation factor DSIF, hSpt4/hSpt5 (176-273)
5OHO 1.6 Å, Crystal structure of the KOWx-KOW4 domain of human DSIF
5U98 2.0 Å, The crystal structure of a self-peptide complexed to Abacavir and HLA-B*57:01
9HVQ 2.0 Å, Structure of the transcribing Pol II-DSIF-PAF-SPT6-RECQL5 complex
9MLC 2.4 Å, Pol II-DSIF-SPT6-PAF1c-TFIIS-IWS1-ELOF1-LEDGF-nucleosome activated elongation complex…
4L1U 2.42 Å, Crystal Structure of Human Rtf1 Plus3 Domain in Complex with Spt5 CTR Phosphopeptide
8UHG 2.7 Å, Structure of paused transcription complex Pol II-DSIF-NELF - poised post-translocated
8UI0 2.7 Å, Structure of poised transcription complex Pol II-DSIF-NELF - pre-translocated
8UHD 2.8 Å, Structure of paused transcription complex Pol II-DSIF-NELF - post-translocated
9EGX 2.9 Å, RNA polymerase II-DSIF-SPT6-PAF1c-TFIIS-IWS1-hexasome, bp +27
9EGY 2.9 Å, RNA polymerase II-DSIF-SPT6-PAF1c-TFIIS-IWS1-nucleosome, bp +27
9EGZ 2.9 Å, RNA polymerase II-DSIF-SPT6-PAF1c-TFIIS-IWS1-SETD2-nucleosome, bp +27

Browse structure collections

About this viewer

MolViewer shows 5OHQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.