Extracellular domain of GLP-1 receptor in complex with GLP-1 variant Ala8Cyc/Thr11Hcs. Determined by X-ray diffraction at 2.0 Å resolution. Released 4 Jul 2018.
Explore 5OTV in 3D Show helices and sheets RCSB PDB PDBe
5OTV contains 16 α-helices and 20 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 32-52 | 21 | |
| α-helix | 54-56 | 3 | |
| β-strand | 62 | 1 | 5 |
| α-helix | 63-64 | 2 | |
| β-strand | 65-66 | 2 | 6 |
| β-strand | 71-72 | 2 | 6 |
| β-strand | 75 | 1 | 5 |
| β-strand | 79-84 | 6 | 7 |
| α-helix | 85-86 | 2 | |
| α-helix | 92-94 | 3 | |
| β-strand | 99-104 | 6 | 7 |
| β-strand | 110 | 1 | 7 |
| β-strand | 112 | 1 | 8 |
| β-strand | 119 | 1 | 8 |
| α-helix | 120 | 1 | |
| β-strand | 122 | 1 | 7 |
| α-helix | 124-126 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 13-33 | 21 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Glucagon-like peptide 1 receptor | A, C | protein | 116 | Homo sapiens | P43220 (AlphaFold model) |
| Glucagon | B, D | protein | 31 | Homo sapiens | P01275 (AlphaFold model) |
>5OTV_1 Glucagon-like peptide 1 receptor (chains A, C) RPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNV SCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEESKRGERSSPEE
>5OTV_2 Glucagon (chains B, D) HCEGXFTSDVSSYLEGQAAKEFIAWLVKGRG
alpha-Helix or beta-Turn? An Investigation into N-Terminally Constrained Analogues of Glucagon-like Peptide 1 (GLP-1) and Exendin-4. Oddo, A., Mortensen, S., Thogersen, H. et al. Biochemistry (2018) 57:4148-4154. DOI 10.1021/acs.biochem.8b00105 · PubMed
Other PDB entries of the same protein (UniProt P43220 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5OTV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.