5QSX: Cohesin subunit SA-1

PanDDA analysis group deposition -- Crystal Structure of human STAG1 in complex with Z2856434812. Determined by X-ray diffraction at 2.34 Å resolution. Released 21 Aug 2019.

Method: X-ray diffraction
Resolution: 2.34 Å
Organism: Homo sapiens
Chains: 4
Atoms: 10,244
Mol. weight: 159.24 kDa
Ligands: O3M
Released: 21 Aug 2019

Explore 5QSX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5QSX contains 83 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 21 helices, 0 β-strands

Element	Residues	Length
α-helix	87-93	7
α-helix	97-111	15
α-helix	113-127	15
α-helix	136-141	6
α-helix	144-152	9
α-helix	163-165	3
α-helix	171-188	18
α-helix	199-211	13
α-helix	216-243	28
α-helix	246-249	4
α-helix	268-291	24
α-helix	292-296	5
α-helix	297-299	3
α-helix	305-321	17
α-helix	323-326	4
α-helix	329-338	10
α-helix	344-358	15
α-helix	361-363	3
α-helix	364-380	17
α-helix	381-383	3
α-helix	389-401	13

Chain B: 21 helices, 0 β-strands

Element	Residues	Length
α-helix	87-93	7
α-helix	97-111	15
α-helix	113-127	15
α-helix	137-140	4
α-helix	144-153	10
α-helix	163-165	3
α-helix	169-171	3
α-helix	174-189	16
α-helix	193-195	3
α-helix	199-210	12
α-helix	216-248	33
α-helix	269-291	23
α-helix	292-296	5
α-helix	297-299	3
α-helix	305-321	17
α-helix	323-326	4
α-helix	329-339	11
α-helix	344-358	15
α-helix	364-380	17
α-helix	381-383	3
α-helix	387-401	15

Chain C: 21 helices, 0 β-strands

Element	Residues	Length
α-helix	87-91	5
α-helix	97-111	15
α-helix	113-127	15
α-helix	136-141	6
α-helix	144-153	10
α-helix	169-171	3
α-helix	174-189	16
α-helix	193-195	3
α-helix	199-211	13
α-helix	216-257	42
α-helix	265-291	27
α-helix	292-296	5
α-helix	297-299	3
α-helix	305-321	17
α-helix	323-326	4
α-helix	329-339	11
α-helix	344-359	16
α-helix	364-367	4
α-helix	368-380	13
α-helix	381-383	3
α-helix	387-402	16

Chain D: 20 helices, 0 β-strands

Element	Residues	Length
α-helix	87-93	7
α-helix	97-111	15
α-helix	113-127	15
α-helix	136-141	6
α-helix	144-152	9
α-helix	169-189	21
α-helix	193-195	3
α-helix	199-211	13
α-helix	216-254	39
α-helix	267-291	25
α-helix	292-296	5
α-helix	297-299	3
α-helix	305-321	17
α-helix	323-326	4
α-helix	329-338	10
α-helix	344-358	15
α-helix	361-363	3
α-helix	364-380	17
α-helix	381-383	3
α-helix	389-401	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cohesin subunit SA-1	A, B, C, D	protein	339	Homo sapiens	Q8WVM7 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>5QSX_1 Cohesin subunit SA-1 (chains A, B, C, D)
SMGGTLFEVVKLGKSAMQSVVDDWIESYKQDRDIALLDLINFFIQCSGCRGTVRIEMFRN
MQNAEIIRKMTEEFDEDSGDYPLTMPGPQWKKFRSNFCEFIGVLIRQCQYSIIYDEYMMD
TVISLLTGLSDSQVRAFRHTSTLAAMKLMTALVNVALNLSIHQDNTQRQYEAERNKMIGK
RANERLELLLQKRKELQENQDEIENMMNSIFKGIFVHRYRDAIAEIRAICIEEIGVWMKM
YSDAFLNDSYLKYVGWTLHDRQGEVRLKCLKALQSLYTNRELFPKLELFTNRFKDRIVSM
TLDKEYDVAVEAIRLVTLILHGSEEALSNEDCENVYHLV

Ligands and cofactors

ID	Name	Formula	Copies
O3M	4-[(3,4-dihydroisoquinolin-2(1H)-yl)methyl]phenol	C16 H17 N O	3

Primary citation

PanDDA analysis group deposition. Newman, J.A., Katis, V.L., Gavard, A.E. et al. To be published.

Other PDB entries of the same protein (UniProt Q8WVM7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6QB5 2.02 Å, Crystal structure of the N-terminal region of human cohesin subunit STAG1
6R7O 2.31 Å, Crystal structure of the central region of human cohesin subunit STAG1
6RRC 2.37 Å, Crystal structure of the N-terminal region of human cohesin subunit STAG1 in complex…
5QSY 2.4 Å, PanDDA analysis group deposition -- Crystal Structure of human STAG1 in complex with…
5QSQ 2.48 Å, PanDDA analysis group deposition -- Crystal Structure of human STAG1 in complex with…
5QST 2.58 Å, PanDDA analysis group deposition -- Crystal Structure of human STAG1 in complex with…
5QSN 2.66 Å, PanDDA analysis group deposition -- Crystal Structure of human STAG1 in complex with…
5QSO 2.7 Å, PanDDA analysis group deposition -- Crystal Structure of human STAG1 in complex with…
5QSU 2.73 Å, PanDDA analysis group deposition -- Crystal Structure of human STAG1 in complex with…
5QSM 2.74 Å, PanDDA analysis group deposition -- Crystal Structure of human STAG1 in complex with…
5QSV 2.76 Å, PanDDA analysis group deposition -- Crystal Structure of human STAG1 in complex with…
5QSP 2.89 Å, PanDDA analysis group deposition -- Crystal Structure of human STAG1 in complex with…

Browse structure collections

About this viewer

MolViewer shows 5QSX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.