6QB5: N-terminal region of human cohesin subunit STAG1

Crystal structure of the N-terminal region of human cohesin subunit STAG1. Determined by X-ray diffraction at 2.02 Å resolution. Released 6 Feb 2019.

Method: X-ray diffraction
Resolution: 2.02 Å
Organism: Homo sapiens
Chains: 4
Atoms: 10,628
Mol. weight: 158.54 kDa
Released: 6 Feb 2019

Explore 6QB5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6QB5 contains 92 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 22 helices, 0 β-strands

Element	Residues	Length
α-helix	87-93	7
α-helix	97-111	15
α-helix	113-127	15
α-helix	136-141	6
α-helix	144-152	9
α-helix	163-165	3
α-helix	169-189	21
α-helix	193-195	3
α-helix	199-211	13
α-helix	216-251	36
α-helix	271-291	21
α-helix	292-296	5
α-helix	297-299	3
α-helix	305-321	17
α-helix	323-326	4
α-helix	329-336	8
α-helix	344-358	15
α-helix	361-363	3
α-helix	364-373	10
α-helix	375-379	5
α-helix	380-383	4
α-helix	387-402	16

Chain B: 25 helices, 0 β-strands

Element	Residues	Length
α-helix	87-92	6
α-helix	97-111	15
α-helix	113-127	15
α-helix	136-141	6
α-helix	144-152	9
α-helix	163-165	3
α-helix	169-171	3
α-helix	174-189	16
α-helix	193-195	3
α-helix	199-211	13
α-helix	216-255	40
α-helix	258	1
α-helix	264-291	28
α-helix	292-296	5
α-helix	297-299	3
α-helix	305-321	17
α-helix	323-326	4
α-helix	329-337	9
α-helix	338-340	3
α-helix	344-358	15
α-helix	361-363	3
α-helix	364-373	10
α-helix	375-380	6
α-helix	381-383	3
α-helix	387-402	16

Chain C: 21 helices, 0 β-strands

Element	Residues	Length
α-helix	87-93	7
α-helix	97-111	15
α-helix	113-127	15
α-helix	136-141	6
α-helix	144-152	9
α-helix	163-165	3
α-helix	174-189	16
α-helix	193-195	3
α-helix	199-211	13
α-helix	216-255	40
α-helix	265-291	27
α-helix	292-296	5
α-helix	297-299	3
α-helix	305-321	17
α-helix	323-326	4
α-helix	329-338	10
α-helix	344-358	15
α-helix	361-367	7
α-helix	368-380	13
α-helix	381-383	3
α-helix	387-403	17

Chain D: 24 helices, 0 β-strands

Element	Residues	Length
α-helix	87-93	7
α-helix	97-111	15
α-helix	113-127	15
α-helix	133-135	3
α-helix	136-139	4
α-helix	144-152	9
α-helix	169-171	3
α-helix	174-189	16
α-helix	193-195	3
α-helix	199-211	13
α-helix	216-250	35
α-helix	267-291	25
α-helix	292-296	5
α-helix	297-299	3
α-helix	305-321	17
α-helix	323-326	4
α-helix	329-336	8
α-helix	337-340	4
α-helix	344-358	15
α-helix	361-363	3
α-helix	364-373	10
α-helix	375-380	6
α-helix	381-383	3
α-helix	387-401	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cohesin subunit SA-1	A, B, C, D	protein	339	Homo sapiens	Q8WVM7 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>6QB5_1 Cohesin subunit SA-1 (chains A, B, C, D)
SMGGTLFEVVKLGKSAMQSVVDDWIESYKQDRDIALLDLINFFIQCSGCRGTVRIEMFRN
MQNAEIIRKMTEEFDEDSGDYPLTMPGPQWKKFRSNFCEFIGVLIRQCQYSIIYDEYMMD
TVISLLTGLSDSQVRAFRHTSTLAAMKLMTALVNVALNLSIHQDNTQRQYEAERNKMIGK
RANERLELLLQKRKELQENQDEIENMMNSIFKGIFVHRYRDAIAEIRAICIEEIGVWMKM
YSDAFLNDSYLKYVGWTLHDRQGEVRLKCLKALQSLYTNRELFPKLELFTNRFKDRIVSM
TLDKEYDVAVEAIRLVTLILHGSEEALSNEDCENVYHLV

Primary citation

STAG1 vulnerabilities for exploiting cohesin synthetic lethality in STAG2-deficient cancers. van der Lelij, P., Newman, J.A., Lieb, S. et al. Life Sci Alliance (2020) 3. DOI 10.26508/lsa.202000725 · PubMed

Other PDB entries of the same protein (UniProt Q8WVM7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6R7O 2.31 Å, Crystal structure of the central region of human cohesin subunit STAG1
5QSX 2.34 Å, PanDDA analysis group deposition -- Crystal Structure of human STAG1 in complex with…
6RRC 2.37 Å, Crystal structure of the N-terminal region of human cohesin subunit STAG1 in complex…
5QSY 2.4 Å, PanDDA analysis group deposition -- Crystal Structure of human STAG1 in complex with…
5QSQ 2.48 Å, PanDDA analysis group deposition -- Crystal Structure of human STAG1 in complex with…
5QST 2.58 Å, PanDDA analysis group deposition -- Crystal Structure of human STAG1 in complex with…
5QSN 2.66 Å, PanDDA analysis group deposition -- Crystal Structure of human STAG1 in complex with…
5QSO 2.7 Å, PanDDA analysis group deposition -- Crystal Structure of human STAG1 in complex with…
5QSU 2.73 Å, PanDDA analysis group deposition -- Crystal Structure of human STAG1 in complex with…
5QSM 2.74 Å, PanDDA analysis group deposition -- Crystal Structure of human STAG1 in complex with…
5QSV 2.76 Å, PanDDA analysis group deposition -- Crystal Structure of human STAG1 in complex with…
5QSP 2.89 Å, PanDDA analysis group deposition -- Crystal Structure of human STAG1 in complex with…

Browse structure collections

About this viewer

MolViewer shows 6QB5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.