6R7O: Central region of human cohesin subunit STAG1

Crystal structure of the central region of human cohesin subunit STAG1. Determined by X-ray diffraction at 2.31 Å resolution. Released 10 Apr 2019.

Method: X-ray diffraction
Resolution: 2.31 Å
Organism: Homo sapiens
Chains: 2
Atoms: 7,088
Mol. weight: 105.51 kDa
Released: 10 Apr 2019

Explore 6R7O in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6R7O contains 51 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 25 helices, 0 β-strands

Element	Residues	Length
α-helix	460-474	15
α-helix	481-496	16
α-helix	499-507	9
α-helix	509-511	3
α-helix	515-518	4
α-helix	519-538	20
α-helix	551-553	3
α-helix	554-581	28
α-helix	586-592	7
α-helix	596-598	3
α-helix	603-606	4
α-helix	610-626	17
α-helix	630-643	14
α-helix	648-677	30
α-helix	685-701	17
α-helix	712-725	14
α-helix	731-754	24
α-helix	759-779	21
α-helix	785-801	17
α-helix	804-807	4
α-helix	812-817	6
α-helix	823-836	14
α-helix	856-877	22
α-helix	883-893	11
α-helix	895-909	15

Chain B: 26 helices, 0 β-strands

Element	Residues	Length
α-helix	461-473	13
α-helix	478-480	3
α-helix	481-487	7
α-helix	489-496	8
α-helix	499-507	9
α-helix	519-538	20
α-helix	551-553	3
α-helix	554-581	28
α-helix	586-592	7
α-helix	596-598	3
α-helix	603-606	4
α-helix	610-626	17
α-helix	630-643	14
α-helix	651-678	28
α-helix	685-702	18
α-helix	712-726	15
α-helix	731-753	23
α-helix	759-779	21
α-helix	785-801	17
α-helix	804-806	3
α-helix	812-817	6
α-helix	823-837	15
α-helix	857-877	21
α-helix	885-889	5
α-helix	894-896	3
α-helix	897-909	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cohesin subunit SA-1	A, B	protein	459	Homo sapiens	Q8WVM7 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6R7O_1 Cohesin subunit SA-1 (chains A, B)
SMSPNGNLIRMLVLFFLESELHEHAAYLVDSLWESSQELLKDWECMTELLLEEPVQGEEA
MSDRQESALIELMVCTIRQAAEAHPPVGRGTGKRVLTAKERKTQIDDRNKLTEHFIITLP
MLLSKYSADAEKVANLLQIPQYFDLEIYSTGRMEKHLDALLKQIKFVVEKHVESDVLEAC
SKTYSILCSEEYTIQNRVDIARSQLIDEFVDRFNHSVEDLLQEGEEADDDDIYNVLSTLK
RLTSFHNAHDLTKWDLFGNCYRLLKTGIEHGAMPEQIVVQALQCSHYSILWQLVKITDGS
PSKEDLLVLRKTVKSFLAVCQQCLSNVNTPVKEQAFMLLCDLLMIFSHQLMTGGREGLQP
LVFNPDTGLQSELLSFVMDHVFIDQDEENQSMEGDEEDEANKIEALHKRRNLLAAFSKLI
IYDIVDMHAAADIFKHYMKYYNDYGDIIKETLSKTRQID

Primary citation

STAG1 vulnerabilities for exploiting cohesin synthetic lethality in STAG2-deficient cancers. van der Lelij, P., Newman, J.A., Lieb, S. et al. Life Sci Alliance (2020) 3. DOI 10.26508/lsa.202000725 · PubMed

Other PDB entries of the same protein (UniProt Q8WVM7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6QB5 2.02 Å, Crystal structure of the N-terminal region of human cohesin subunit STAG1
5QSX 2.34 Å, PanDDA analysis group deposition -- Crystal Structure of human STAG1 in complex with…
6RRC 2.37 Å, Crystal structure of the N-terminal region of human cohesin subunit STAG1 in complex…
5QSY 2.4 Å, PanDDA analysis group deposition -- Crystal Structure of human STAG1 in complex with…
5QSQ 2.48 Å, PanDDA analysis group deposition -- Crystal Structure of human STAG1 in complex with…
5QST 2.58 Å, PanDDA analysis group deposition -- Crystal Structure of human STAG1 in complex with…
5QSN 2.66 Å, PanDDA analysis group deposition -- Crystal Structure of human STAG1 in complex with…
5QSO 2.7 Å, PanDDA analysis group deposition -- Crystal Structure of human STAG1 in complex with…
5QSU 2.73 Å, PanDDA analysis group deposition -- Crystal Structure of human STAG1 in complex with…
5QSM 2.74 Å, PanDDA analysis group deposition -- Crystal Structure of human STAG1 in complex with…
5QSV 2.76 Å, PanDDA analysis group deposition -- Crystal Structure of human STAG1 in complex with…
5QSP 2.89 Å, PanDDA analysis group deposition -- Crystal Structure of human STAG1 in complex with…

Browse structure collections

About this viewer

MolViewer shows 6R7O directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.