5R4M: Nucleosome-remodeling factor subunit BPTF

PanDDA analysis group deposition -- CRYSTAL STRUCTURE OF THE BROMODOMAIN OF HUMAN NUCLEOSOME-REMODELING FACTOR SUBUNIT BPTF in complex with FMOPL000513a. Determined by X-ray diffraction at 1.11 Å resolution. Released 1 Apr 2020.

Method: X-ray diffraction
Resolution: 1.11 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,243
Mol. weight: 14.9 kDa
Ligands: M25
Released: 1 Apr 2020

Explore 5R4M in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5R4M contains 9 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	2795-2799	5
β-strand	2801	1	1
α-helix	2802-2803	2
α-helix	2804-2818	15
α-helix	2824-2826	3
α-helix	2829-2831	3
α-helix	2838-2841	4
α-helix	2848-2856	9
β-strand	2862	1	1
α-helix	2863-2880	18
α-helix	2886-2910	25

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Nucleosome-remodeling factor subunit BPTF	A	protein	123	Homo sapiens	Q12830

Sequence of entity 1 (A), FASTA

>5R4M_1 Nucleosome-remodeling factor subunit BPTF (chains A)
SMSTEDAMTVLTPLTEKDYEGLKRVLRSLQAHKMAWPFLEPVDPNDAPDYYGVIKEPMDL
ATMEERVQRRYYEKLTEFVADMTKIFDNCRYYNPSDSPFYQCAEVLESFFVQKLKGFKAS
RSH

Ligands and cofactors

ID	Name	Formula	Copies
M25	N-{2-[4-(aminosulfonyl)phenyl]ethyl}acetamide	C10 H14 N2 O3 S	1

Water and common crystallization additives (TRS, DMS) are not listed.

Primary citation

PanDDA analysis group deposition. Talon, R., Krojer, T., Fairhead, M. et al. To be published.

Other PDB entries of the same protein (UniProt Q12830), best resolution first:

8AG2 1.02 Å, Crystal structure of the BPTF bromodomain in complex with BI-7190
5R4O 1.05 Å, PanDDA analysis group deposition of ground-state model of BROMODOMAIN OF HUMAN…
5R4L 1.13 Å, PanDDA analysis group deposition -- CRYSTAL STRUCTURE OF THE BROMODOMAIN OF HUMAN…
5R4K 1.17 Å, PanDDA analysis group deposition -- CRYSTAL STRUCTURE OF THE BROMODOMAIN OF HUMAN…
5R4H 1.18 Å, PanDDA analysis group deposition -- CRYSTAL STRUCTURE OF THE BROMODOMAIN OF HUMAN…
7K6S 1.23 Å, Crystal structure of the bromodomain (BD) of human Bromodomain and PHD finger-containing…
5R4G 1.25 Å, PanDDA analysis group deposition -- CRYSTAL STRUCTURE OF THE BROMODOMAIN OF HUMAN…
5R4I 1.28 Å, PanDDA analysis group deposition -- CRYSTAL STRUCTURE OF THE BROMODOMAIN OF HUMAN…
5R4N 1.28 Å, PanDDA analysis group deposition -- CRYSTAL STRUCTURE OF THE BROMODOMAIN OF HUMAN…
9ZUK 1.35 Å, Crystal structure of BPTF bromodomain bound to BZ1
5R4J 1.39 Å, PanDDA analysis group deposition -- CRYSTAL STRUCTURE OF THE BROMODOMAIN OF HUMAN…
7LPK 1.39 Å, Crystal structure of BPTF bromodomain in complex with inhibitor HZ-03-112

Browse structure collections

About this viewer

MolViewer shows 5R4M directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.