9ZUK: BPTF bromodomain

Crystal structure of BPTF bromodomain bound to BZ1. Determined by X-ray diffraction at 1.35 Å resolution. Released 16 Sept 2026.

Method: X-ray diffraction
Resolution: 1.35 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,377
Mol. weight: 29.47 kDa
Ligands: A1C4C
Released: 16 Sept 2026

Explore 9ZUK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9ZUK contains 17 α-helices and 2 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	2930-2945	16
α-helix	2950-2952	3
α-helix	2955-2957	3
α-helix	2958-2960	3
α-helix	2964-2967	4
α-helix	2974-2982	9
α-helix	2989-3006	18
α-helix	3012-3034	23

Chain B: 9 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	2921-2923	3
β-strand	2927	1	1
α-helix	2928	1
α-helix	2930-2945	16
α-helix	2950-2952	3
α-helix	2955-2957	3
α-helix	2964-2967	4
α-helix	2974-2982	9
β-strand	2988	1	1
α-helix	2989-3006	18
α-helix	3012-3034	23

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Nucleosome-remodeling factor subunit BPTF	A, B	protein	123	Homo sapiens	Q12830

Sequence of entity 1 (A, B), FASTA

>9ZUK_1 Nucleosome-remodeling factor subunit BPTF (chains A, B)
SMSTEDAMTVLTPLTEKDYEGLKRVLRSLQAHKMAWPFLEPVDPNDAPDYYGVIKEPMDL
ATMEERVQRRYYEKLTEFVADMTKIFDNCRYYNPSDSPFYQCAEVLESFFVQKLKGFKAS
RSH

Ligands and cofactors

ID	Name	Formula	Copies
A1C4C	5-[4-(2-aminoethyl)anilino]-4-chloro-2-methylpyridazin-3(2H)-one	C13 H15 Cl N4 O	2

Primary citation

Differential Water Networks Guide Selectivity Optimization of a Cell Active BPTF Inhibitor in Neuroblastoma. Babu, K., Tsou, C.J., Das, S. et al. Angew Chem Int Ed Engl (2026):e4580510-e4580510. DOI 10.1002/anie.4580510 · PubMed

Other PDB entries of the same protein (UniProt Q12830), best resolution first:

8AG2 1.02 Å, Crystal structure of the BPTF bromodomain in complex with BI-7190
5R4O 1.05 Å, PanDDA analysis group deposition of ground-state model of BROMODOMAIN OF HUMAN…
5R4M 1.11 Å, PanDDA analysis group deposition -- CRYSTAL STRUCTURE OF THE BROMODOMAIN OF HUMAN…
5R4L 1.13 Å, PanDDA analysis group deposition -- CRYSTAL STRUCTURE OF THE BROMODOMAIN OF HUMAN…
5R4K 1.17 Å, PanDDA analysis group deposition -- CRYSTAL STRUCTURE OF THE BROMODOMAIN OF HUMAN…
5R4H 1.18 Å, PanDDA analysis group deposition -- CRYSTAL STRUCTURE OF THE BROMODOMAIN OF HUMAN…
7K6S 1.23 Å, Crystal structure of the bromodomain (BD) of human Bromodomain and PHD finger-containing…
5R4G 1.25 Å, PanDDA analysis group deposition -- CRYSTAL STRUCTURE OF THE BROMODOMAIN OF HUMAN…
5R4I 1.28 Å, PanDDA analysis group deposition -- CRYSTAL STRUCTURE OF THE BROMODOMAIN OF HUMAN…
5R4N 1.28 Å, PanDDA analysis group deposition -- CRYSTAL STRUCTURE OF THE BROMODOMAIN OF HUMAN…
5R4J 1.39 Å, PanDDA analysis group deposition -- CRYSTAL STRUCTURE OF THE BROMODOMAIN OF HUMAN…
7LPK 1.39 Å, Crystal structure of BPTF bromodomain in complex with inhibitor HZ-03-112

Browse structure collections

About this viewer

MolViewer shows 9ZUK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.