Crystal structure of the bromodomain (BD) of human Bromodomain and PHD finger-containing Transcription Factor (BPTF) bound to Compound 4 (SKT1174). Determined by X-ray diffraction at 1.23 Å resolution. Released 9 Dec 2020.
Explore 7K6S in 3D Show helices and sheets RCSB PDB PDBe
7K6S contains 8 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 2921-2925 | 5 | |
| β-strand | 2927 | 1 | 1 |
| α-helix | 2930-2945 | 16 | |
| α-helix | 2950-2952 | 3 | |
| α-helix | 2955-2957 | 3 | |
| α-helix | 2964-2967 | 4 | |
| α-helix | 2974-2982 | 9 | |
| β-strand | 2988 | 1 | 1 |
| α-helix | 2989-3006 | 18 | |
| α-helix | 3012-3034 | 23 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Nucleosome-remodeling factor subunit BPTF | A | protein | 123 | Homo sapiens | Q12830 |
>7K6S_1 Nucleosome-remodeling factor subunit BPTF (chains A) SMSTEDAMTVLTPLTEKDYEGLKRVLRSLQAHKMAWPFLEPVDPNDAPDYYGVIKEPMDL ATMEERVQRRYYEKLTEFVADMTKIFDNCRYYNPSDSPFYQCAEVLESFFVQKLKGFKAS RSH
| ID | Name | Formula | Copies |
|---|---|---|---|
| VYM | (7-amino-3,4-dihydroquinolin-1(2H)-yl)(cyclopropyl)methanone | C13 H16 N2 O | 1 |
Water and common crystallization additives (EDO, GOL, CL) are not listed.
New inhibitors for the BPTF bromodomain enabled by structural biology and biophysical assay development. Ycas, P.D., Zahid, H., Chan, A. et al. Org Biomol Chem (2020) 18:5174-5182. DOI 10.1039/d0ob00506a · PubMed
Other PDB entries of the same protein (UniProt Q12830), best resolution first:
MolViewer shows 7K6S directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.