5R69: YEATS domain-containing protein 4

XChem group deposition -- Crystal Structure of human YEATS4 in complex with XS038644e. Determined by X-ray diffraction at 1.83 Å resolution. Released 30 Dec 2020.

Method: X-ray diffraction
Resolution: 1.83 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,372
Mol. weight: 43.21 kDa
Ligands: ZHA
Released: 30 Dec 2020

Explore 5R69 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5R69 contains 7 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	20-33	14	3
β-strand	45-53	9	3
α-helix	59-61	3
β-strand	63-69	7	4
β-strand	78-81	4	4
β-strand	86-92	7	3
β-strand	97-104	8	4
α-helix	110-111	2
β-strand	112-117	6	4
β-strand	133-145	13	3
α-helix	149-156	8
α-helix	159-161	3

Chain B: 3 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	20-33	14	1
β-strand	45-53	9	1
α-helix	59-61	3
β-strand	63-69	7	2
β-strand	78-81	4	2
β-strand	86-92	7	1
β-strand	97-104	8	2
α-helix	110-111	2
β-strand	112-117	6	2
β-strand	134-145	12	1
α-helix	149-155	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
YEATS domain-containing protein 4	A, B	protein	181	Homo sapiens	O95619 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5R69_1 YEATS domain-containing protein 4 (chains A, B)
MGVTIVKPIVYGNVARYFGKKREEDGHTHQWTVYVKPYRNEDMSAYVKKIQFKLHESYGN
PLRVVTKPPYEITETGWGEFEIIIKIFFIDPNERPVTLYHLLKLFQSDTNAMLGKKTVVS
EFYDEMIFQDPTAMMQQLLTTSRQLTLGAYKHETEFAELEVKTREKLEAAKKKTAHHHHH
H

Ligands and cofactors

ID	Name	Formula	Copies
ZHA	~{N}-(5-oxidanylidene-7,8-dihydro-6~{H}-naphthalen-2-yl)ethanamide	C12 H13 N O2	2

Water and common crystallization additives (EDO) are not listed.

Primary citation

XChem group deposition. Raux, B., Krojer, T., von Delft, F. et al. To be published.

Other PDB entries of the same protein (UniProt O95619 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8IJ0 1.52 Å, Crystal structure of GAS41 YEATS domain in complex with H3K9ac peptide
7EIF 1.58 Å, Crystal structure of GAS41 YEATS domain
5R68 1.64 Å, XChem group deposition -- Crystal Structure of human YEATS4 in complex with FM000199e
9X8S 1.7 Å, Crystal structure of the human GAS41 YEATS domain in complex with an acetylated YFV…
5VNA 2.1 Å, Crystal structure of human YEATS domain
8IIZ 2.1 Å, Crystal structure of MBP fused GAS41 YEATS domain in complex with H3K27ac peptide
7JFY 2.1 Å, GAS41 YEATS domain in complex with 5
5XTZ 2.1 Å, Crystal structure of GAS41 YEATS bound to H3K27ac peptide
8IIY 2.15 Å, Crystal structure of MBP fused GAS41 YEATS domain in complex with H3K14ac peptide
8I60 2.3 Å, Crystal structure of GAS41 YEATS domain in complex with histone H3K27cr
9O4Y 2.3 Å, GAS41 YEATS domain in complex with DLG-1
5VNB 2.4 Å, YEATS in complex with histone H3

Browse structure collections

About this viewer

MolViewer shows 5R69 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.