8I60: GAS41 YEATS domain

Crystal structure of GAS41 YEATS domain in complex with histone H3K27cr. Determined by X-ray diffraction at 2.3 Å resolution. Released 26 Jul 2023.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Homo sapiens
Chains: 4
Atoms: 1,859
Mol. weight: 35.75 kDa
Released: 26 Jul 2023

Explore 8I60 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8I60 contains 4 α-helices and 20 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	203-204	2	3

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	204	1	6

Chain C: 1 helix, 9 β-strands

Element	Residues	Length	Sheet
β-strand	19-33	15	1
β-strand	45-53	9	1
α-helix	59-61	3
β-strand	63-69	7	2
β-strand	78-81	4	2
β-strand	86-92	7	1
β-strand	95-96	2	3
β-strand	97-104	8	2
β-strand	112-117	6	2
β-strand	133-146	14	1

Chain D: 3 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	25-33	9	4
β-strand	45-53	9	4
α-helix	59-61	3
β-strand	66-69	4	5
β-strand	78-81	4	5
α-helix	85	1
β-strand	86-92	7	4
β-strand	95	1	6
β-strand	97-100	4	5
β-strand	114-117	4	5
α-helix	124-128	5
β-strand	134-138	5	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
YEATS domain-containing protein 4	C, D	protein	142	Homo sapiens	O95619 (AlphaFold model)
Ala-arg-kcr-ser-ala-pro	A, B	protein	13	Homo sapiens	P68431 (AlphaFold model)

Sequence of entity 1 (C, D), FASTA

>8I60_1 YEATS domain-containing protein 4 (chains C, D)
GSDSGGRVKGVTIVKPIVYGNVARYFGKKREEDGHTHQWTVYVKPYRNEDMSAYVKKIQF
KLHESYGNPLRVVTKPPYEITETGWGEFEIIIKIFFIDPNERPVTLYHLLKLFQSDTNAM
LGKKTVVSEFYDEMIFQDPTAM

Sequence of entity 2 (A, B), FASTA

>8I60_2 ALA-ARG-KCR-SER-ALA-PRO (chains A, B)
ATKAARXSAPATG

Primary citation

Histone H3 lysine 27 crotonylation mediates gene transcriptional repression in chromatin. Liu, N., Konuma, T., Sharma, R. et al. Mol Cell (2023) 83:2206-2221.e11. DOI 10.1016/j.molcel.2023.05.022 · PubMed

Other PDB entries of the same protein (UniProt O95619 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8IJ0 1.52 Å, Crystal structure of GAS41 YEATS domain in complex with H3K9ac peptide
7EIF 1.58 Å, Crystal structure of GAS41 YEATS domain
5R68 1.64 Å, XChem group deposition -- Crystal Structure of human YEATS4 in complex with FM000199e
9X8S 1.7 Å, Crystal structure of the human GAS41 YEATS domain in complex with an acetylated YFV…
5R69 1.83 Å, XChem group deposition -- Crystal Structure of human YEATS4 in complex with XS038644e
5VNA 2.1 Å, Crystal structure of human YEATS domain
8IIZ 2.1 Å, Crystal structure of MBP fused GAS41 YEATS domain in complex with H3K27ac peptide
7JFY 2.1 Å, GAS41 YEATS domain in complex with 5
5XTZ 2.1 Å, Crystal structure of GAS41 YEATS bound to H3K27ac peptide
8IIY 2.15 Å, Crystal structure of MBP fused GAS41 YEATS domain in complex with H3K14ac peptide
9O4Y 2.3 Å, GAS41 YEATS domain in complex with DLG-1
5VNB 2.4 Å, YEATS in complex with histone H3

Browse structure collections

About this viewer

MolViewer shows 8I60 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.