5T43: Apo-form Human Tear Lipocalin

NMR Structure of Apo-form Human Tear Lipocalin. Determined by solution NMR. Released 30 Aug 2017.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 1,223
Mol. weight: 17.45 kDa
Released: 30 Aug 2017

Explore 5T43 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5T43 contains 1 α-helix and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 13 β-strands

Element	Residues	Length	Sheet
β-strand	15-17	3	1
β-strand	19-22	4	2
β-strand	33-36	4	1
β-strand	39-44	6	1
β-strand	48-57	10	1
β-strand	60-68	9	1
β-strand	69-70	2	2
β-strand	77-78	2	2
β-strand	85-90	6	2
β-strand	97-104	8	2
β-strand	109-116	8	2
α-helix	124-136	13
β-strand	145	1	2
β-strand	149	1	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Lipocalin-1	A	protein	158	Homo sapiens	P31025 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5T43_1 Lipocalin-1 (chains A)
HHLLASDEEIQDVSGTWYLKAMTVDREFPEMNLESVTPMTLTTLEGGNLEAKVTMLISGR
CQEVKAVLEKTDEPGKYTADGGKHVAYIIRSHVKDHYIFYSEGELHGKPVRGVKLVGRDP
KNNLEALEDFEKAAGARGLSTESILIPRQSETCSPGSD

Primary citation

NMR Structure of Apo-form Human Tear Lipocalin. Vogel, H.J., Liu, Z. To be published.

Other PDB entries of the same protein (UniProt P31025 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1XKI 1.8 Å, Crystal structure of human tear lipocalin/von Ebners gland protein
4QAF 1.8 Å, Crystal structure of an engineered lipocalin (Anticalin) in complex with VEGF(8-109)
3EYC 2.6 Å, New crystal structure of human tear lipocalin in complex with 1,4-butanediol in space…

Browse structure collections

About this viewer

MolViewer shows 5T43 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.