Crystal Structure of Adaptor Protein 2 Associated Kinase (AAK1) in complex with BIBF 1120. Determined by X-ray diffraction at 1.9 Å resolution. Released 2 Nov 2016.
Explore 5TE0 in 3D Show helices and sheets RCSB PDB PDBe
5TE0 contains 17 α-helices and 16 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 31-34 | 4 | |
| β-strand | 38-41 | 4 | 1 |
| β-strand | 44-55 | 12 | 1 |
| β-strand | 58-64 | 7 | 1 |
| β-strand | 70-78 | 9 | 1 |
| α-helix | 81-97 | 17 | |
| β-strand | 103 | 1 | 2 |
| α-helix | 104-105 | 2 | |
| β-strand | 106-113 | 8 | 1 |
| β-strand | 120-127 | 8 | 1 |
| β-strand | 132-133 | 2 | 2 |
| α-helix | 134-139 | 6 | |
| α-helix | 148-167 | 20 | |
| β-strand | 173 | 1 | 3 |
| α-helix | 179-181 | 3 | |
| β-strand | 182-184 | 3 | 2 |
| β-strand | 190-192 | 3 | 2 |
| β-strand | 199 | 1 | 3 |
| β-strand | 203 | 1 | 4 |
| α-helix | 205-208 | 4 | |
| α-helix | 210-220 | 11 | |
| α-helix | 223-225 | 3 | |
| α-helix | 228-231 | 4 | |
| β-strand | 239 | 1 | 4 |
| α-helix | 242-257 | 16 | |
| α-helix | 266-271 | 6 | |
| β-strand | 275-276 | 2 | 5 |
| α-helix | 284-293 | 10 | |
| α-helix | 304-315 | 12 | |
| α-helix | 327-330 | 4 | |
| α-helix | 333-336 | 4 | |
| β-strand | 337-338 | 2 | 5 |
| α-helix | 339-344 | 6 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| AP2-associated protein kinase 1 | A | protein | 347 | Homo sapiens | Q2M2I8 (AlphaFold model) |
>5TE0_1 AP2-associated protein kinase 1 (chains A) MTSGLGSGYIGRVFGIGRQQVTVDEVLAEGGFAIVFLVRTSNGMKCALKRMFVNNEHDLQ VCKREIQIMRDLSGHKNIVGYIDSSINNVSSGDVWEVLILMDFCRGGQVVNLMNQRLQTG FTENEVLQIFCDTCEAVARLHQCKTPIIHRDLKVENILLHDRGHYVLCDFGSATNKFQNP QTEGVNAVEDEIKKYTTLSYRAPEMVNLYSGKIITTKADIWALGCLLYKLCYFTLPFGES QVAICDGNFTIPDNSRYSQDMHCLIRYMLEPDPDKRPDIYQVSYFSFKLLKKECPIPNVQ NSPIPAKLPEPVKASEAAAKKTQPKARLTDPIPTTETSIAAENLYFQ
| ID | Name | Formula | Copies |
|---|---|---|---|
| XIN | methyl (3Z)-3-{[(4-{methyl[(4-methylpiperazin-1-yl)acetyl]amino}phenyl)amino](p… | C31 H33 N5 O4 | 1 |
Water and common crystallization additives (PEG, GOL) are not listed.
Crystal Structure of Adaptor Protein 2 Associated Kinase (AAK1) in complex with BIBF 1120. Counago, R.M., Elkins, J.M., Arrowsmith, C.H. et al. To be published.
Other PDB entries of the same protein (UniProt Q2M2I8 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5TE0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.