Crystal Structure of Human Cadherin-23 EC6-8. Determined by X-ray diffraction at 2.92 Å resolution. Released 27 Dec 2017.
Explore 5TFM in 3D Show helices and sheets RCSB PDB PDBe
5TFM contains 13 α-helices and 28 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 537-538 | 2 | 1 |
| β-strand | 543-548 | 6 | 2 |
| β-strand | 554-560 | 7 | 3 |
| β-strand | 562-563 | 2 | 1 |
| β-strand | 574-580 | 7 | 2 |
| α-helix | 584-586 | 3 | |
| β-strand | 587-592 | 6 | 3 |
| β-strand | 595-600 | 6 | 3 |
| α-helix | 606-608 | 3 | |
| α-helix | 610-612 | 3 | |
| β-strand | 613-621 | 9 | 2 |
| β-strand | 629-639 | 11 | 2 |
| α-helix | 640 | 1 | |
| β-strand | 647-648 | 2 | 4 |
| β-strand | 652-658 | 7 | 5 |
| α-helix | 661-662 | 2 | |
| β-strand | 666-669 | 4 | 6 |
| β-strand | 672-673 | 2 | 4 |
| α-helix | 683-685 | 3 | |
| β-strand | 687-691 | 5 | 5 |
| β-strand | 696-698 | 3 | 6 |
| β-strand | 704-707 | 4 | 6 |
| β-strand | 718-726 | 9 | 5 |
| α-helix | 731-733 | 3 | |
| β-strand | 736-746 | 11 | 5 |
| α-helix | 747 | 1 | |
| β-strand | 754-755 | 2 | 7 |
| α-helix | 758 | 1 | |
| β-strand | 760-764 | 5 | 8 |
| α-helix | 768-769 | 2 | |
| β-strand | 773-776 | 4 | 9 |
| β-strand | 779-780 | 2 | 7 |
| α-helix | 785-788 | 4 | |
| β-strand | 790-794 | 5 | 8 |
| β-strand | 801-803 | 3 | 9 |
| β-strand | 809-812 | 4 | 9 |
| α-helix | 824-828 | 5 | |
| β-strand | 832-839 | 8 | 8 |
| α-helix | 844-845 | 2 | |
| β-strand | 846 | 1 | 8 |
| β-strand | 851-857 | 7 | 8 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Cadherin-23 | A | protein | 339 | Homo sapiens | Q9H251 (AlphaFold model) |
>5TFM_1 Cadherin-23 (chains A) MNVPTFQKDAYVGALRENEPSVTQLVRLRATDEDSPPNNQITYSIVSASAFGSYFDISLY EGYGVISVSRPLDYEQISNGLIYLTVMAMDAGNPPLNSTVPVTIEVFDENDNPPTFSKPA YFVSVVENIMAGATVLFLNATDLDRSREYGQESIIYSLEGSTQFRINARSGEITTTSLLD RETKSEYILIVRAVDGGVGHNQKTGIATVNITLLDINDNHPTWKDAPYYINLVEMTPPDS DVTTVVAVDPDLGENGTLVYSIQPPNKFYSLNSTTGKIRTTHAMLDRENPDPHEAELMRK IVVSVTDCGRPPLKATSSATVFVNLLDLNDNLEHHHHHH
| ID | Name | Formula | Copies |
|---|---|---|---|
| CA | Calcium ion | Ca | 5 |
Water and common crystallization additives (NA) are not listed.
Zooming in on Cadherin-23: Structural Diversity and Potential Mechanisms of Inherited Deafness. Jaiganesh, A., De-la-Torre, P., Patel, A.A. et al. Structure (2018) 26:1210. DOI 10.1016/j.str.2018.06.003 · PubMed
Other PDB entries of the same protein (UniProt Q9H251 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5TFM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.