5WJ8: Human Cadherin-23 EC13-14

Crystal Structure of Human Cadherin-23 EC13-14. Determined by X-ray diffraction at 1.86 Å resolution. Released 4 Jul 2018.

Method: X-ray diffraction
Resolution: 1.86 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,771
Mol. weight: 24.98 kDa
Ligands: CA
Released: 4 Jul 2018

Explore 5WJ8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5WJ8 contains 8 α-helices and 18 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	1289-1290	2	1
β-strand	1295-1300	6	2
α-helix	1303-1304	2
β-strand	1308-1311	4	3
β-strand	1314-1315	2	1
α-helix	1322-1323	2
β-strand	1324-1327	4	2
α-helix	1333-1338	6
β-strand	1339-1341	3	3
β-strand	1347-1350	4	3
β-strand	1361-1369	9	2
α-helix	1375-1376	2
β-strand	1377-1386	10	2
α-helix	1387	1
β-strand	1394-1395	2	4
β-strand	1402-1406	5	5
α-helix	1409-1410	2
β-strand	1414-1419	6	6
β-strand	1420-1421	2	4
α-helix	1426-1429	4
β-strand	1431-1437	7	5
α-helix	1440-1442	3
β-strand	1444-1449	6	6
β-strand	1453-1458	6	6
β-strand	1469-1478	10	5
β-strand	1485-1495	11	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cadherin-23	A	protein	225	Homo sapiens	Q9H251 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5WJ8_1 Cadherin-23 (chains A)
MDEAVQFSNASYEAAILENLALGTEIVRVQAYSIDNLNQITYRFNAYTSTQAKALFKIDA
ITGVITVQGLVDREKGDFYTLTVVADDGGPKVDSTVKVYITVLDENDNSPRFDFTSDSAV
SIPEDCPVGQRVATVKAWDPDAGSNGQVVFSLASGNIAGAFEIVTTNDSIGEVFVARPLD
REELDHYILQVVASDRGTPPRKKDHILQVTILDINDNLEHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	4

Water and common crystallization additives (CL, K) are not listed.

Primary citation

Zooming in on Cadherin-23: Structural Diversity and Potential Mechanisms of Inherited Deafness. Jaiganesh, A., De-la-Torre, P., Patel, A.A. et al. Structure (2018) 26:1210. DOI 10.1016/j.str.2018.06.003 · PubMed

Other PDB entries of the same protein (UniProt Q9H251 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5TFM 2.92 Å, Crystal Structure of Human Cadherin-23 EC6-8
5VVM 3.54 Å, Crystal structure of human CDH23 EC21-23
2KBR Solution structure of harmonin N terminal domain in complex with a internal peptide of…
2KBS Solution structure of harmonin PDZ2 in complex with the carboxyl tail peptide of…
2LSR Solution structure of harmonin N terminal domain in complex with a exon68 encoded…

Browse structure collections

About this viewer

MolViewer shows 5WJ8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.