2KBS: Harmonin PDZ2

Solution structure of harmonin PDZ2 in complex with the carboxyl tail peptide of cadherin23. Determined by solution NMR. Released 31 Mar 2009.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 742
Mol. weight: 10.59 kDa
Released: 31 Mar 2009

Explore 2KBS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2KBS contains 4 α-helices and 7 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	10-15	6	1
β-strand	25-29	5	1
β-strand	37-42	6	1
α-helix	47-51	5
β-strand	58-62	5	1
β-strand	65-66	2	1
α-helix	72-81	10
β-strand	85-90	6	1
α-helix	95-98	4

Chain B: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
α-helix	112-114	3
β-strand	115-117	3	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Harmonin	A	protein	92	Homo sapiens	Q9Y6N9 (AlphaFold model)
octameric peptide from Cadherin-23	B	protein	8	Homo sapiens	Q9H251 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2KBS_1 Harmonin (chains A)
KEKKVFISLVGSRGLGCSISSGPIQKPGIFISHVKPGSLSAEVGLEIGDQIVEVNGVDFS
NLDHKEAVNVLKSSRSLTISIVAAAGRELFMT

Sequence of entity 2 (B), FASTA

>2KBS_2 octameric peptide from Cadherin-23 (chains B)
TPLEITEL

Primary citation

Assembling stable hair cell tip link complex via multidentate interactions between harmonin and cadherin 23. Pan, L., Yan, J., Wu, L. et al. Proc Natl Acad Sci U S A (2009) 106:5575-5580. DOI 10.1073/pnas.0901819106 · PubMed

Other PDB entries of the same protein (UniProt Q9Y6N9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5XBF 1.8 Å, Crystal Structure of Myo7b C-terminal MyTH4-FERM in complex with USH1C PDZ3
7X2E 1.85 Å, Structure of USH1C PDZ2 and coiled-coil in complex with CDHR2 C-terminal tail
5MV8 1.88 Å, Structure of human Myosin 7b C-terminal MyTH4-FERM domain in complex with harmonin-a…
3K1R 2.3 Å, Structure of harmonin NPDZ1 in complex with the SAM-PBM of Sans
5MV9 2.6 Å, Structure of human Myosin 7a C-terminal MyTH4-FERM domain in complex with harmonin-a…
5F3X 2.65 Å, Crystal structure of Harmonin NPDZ1 in complex with ANKS4B SAM-PBM
1X5N Solution structure of the second PDZ domain of harmonin protein
2KBQ Solution structure of harmonin N terminal domain
2KBR Solution structure of harmonin N terminal domain in complex with a internal peptide of…
2LSR Solution structure of harmonin N terminal domain in complex with a exon68 encoded…

Browse structure collections

About this viewer

MolViewer shows 2KBS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.