Factor xia in complex with the inhibitor ((15S)-18-chloro- 15-(((2E)-3-(5-chloro-2-(1H-tetrazol-1-yl)phenyl)-2- propenoyl)amino)-17,19-DIAZATRICYCLO[14.2.1.0~2,7~]NONADECA-1(18),2,4,6,16(19)-pentaen-5-yl)carbamate. Determined by X-ray diffraction at 1.55 Å resolution. Released 1 Mar 2017.
Explore 5TKS in 3D Show helices and sheets RCSB PDB PDBe
5TKS contains 13 α-helices and 21 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 17 | 1 | 1 |
| β-strand | 20-21 | 2 | 2 |
| α-helix | 22-23 | 2 | |
| β-strand | 30-35 | 6 | 3 |
| β-strand | 39-48 | 10 | 3 |
| β-strand | 51-54 | 4 | 3 |
| α-helix | 56-58A | 4 | |
| α-helix | 63-65 | 3 | |
| β-strand | 65A-67 | 4 | 3 |
| β-strand | 72 | 1 | 4 |
| α-helix | 73-75 | 3 | |
| β-strand | 83-90 | 8 | 3 |
| α-helix | 97-99 | 3 | |
| β-strand | 104-108 | 5 | 3 |
| α-helix | 111-114 | 4 | |
| β-strand | 115 | 1 | 5 |
| β-strand | 118 | 1 | 5 |
| α-helix | 120-121 | 2 | |
| β-strand | 122 | 1 | 2 |
| α-helix | 123-125 | 3 | |
| α-helix | 126-128 | 3 | |
| β-strand | 136-140 | 5 | 2 |
| β-strand | 154 | 1 | 4 |
| α-helix | 155 | 1 | |
| β-strand | 156-159 | 4 | 2 |
| β-strand | 162-163 | 2 | 2 |
| α-helix | 165-170 | 7 | |
| β-strand | 180-183 | 4 | 2 |
| β-strand | 189 | 1 | 1 |
| β-strand | 198-203 | 6 | 2 |
| β-strand | 206-215 | 10 | 2 |
| β-strand | 226-230 | 5 | 2 |
| α-helix | 231-234 | 4 | |
| α-helix | 235-242 | 8 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Coagulation factor XI | A | protein | 244 | Homo sapiens | P03951 (AlphaFold model) |
>5TKS_1 Coagulation factor XI (chains A) IVGGTASVRGEWPWQVTLHTTSPTQRHLCGGSIIGNQWILTAAHCFYGVESPKILRVYSG ILNQSEIKEDTSFFGVQEIIIHDQYKMAESGYDIALLKLETTVGYGDSQRPICLPSKGDR NVIYTDCWVTGWGYRKLRDKIQNTLQKAKIPLVTNEECQKRYRGHKITHKMICAGYREGG KDACKGDSGGPLSCKHNEVWHLVGITSWGEGCAQRERPGVYTNVVEYVDWILEKTQAVHH HHHH
| ID | Name | Formula | Copies |
|---|---|---|---|
| 7DL | ((15S)-18-chloro- 15-(((2E)-3-(5-chloro-2-(1H-tetrazol-1-yl)phenyl)-2-… | C29 H30 Cl2 N8 O3 | 1 |
Water and common crystallization additives (EDO, SO4) are not listed.
Structure-Based Design of Macrocyclic Factor XIa Inhibitors: Discovery of the Macrocyclic Amide Linker. Corte, J.R., Fang, T., Osuna, H. et al. J Med Chem (2017) 60:1060-1075. DOI 10.1021/acs.jmedchem.6b01460 · PubMed
Other PDB entries of the same protein (UniProt P03951 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5TKS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.