5TLZ: Fructose-bisphosphate aldolase A

Fructose-1,6-bisphosphate aldolase from rabbit muscle in complex with the inhibitor naphthalene 2,6-bisphosphate. Determined by X-ray diffraction at 1.97 Å resolution. Released 25 Oct 2017.

Method: X-ray diffraction
Resolution: 1.97 Å
Organism: Oryctolagus cuniculus
Chains: 4
Atoms: 12,322
Mol. weight: 158.52 kDa
Ligands: N26
Released: 25 Oct 2017

Explore 5TLZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5TLZ contains 73 α-helices and 54 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and C: 19 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	9-22	14
β-strand	28-32	5	1
α-helix	36-44	9
α-helix	52-63	12
α-helix	67-69	3
β-strand	73-78	6	1
α-helix	80-83	4
β-strand	86	1	2
β-strand	92	1	2
α-helix	93-99	7
α-helix	102	1
β-strand	103-107	5	1
β-strand	112-114	3	3
β-strand	122-124	3	3
α-helix	130-139	10
β-strand	144-151	8	1
β-strand	154	1	4
β-strand	157	1	4
α-helix	160-179	20
β-strand	183-190	8	1
α-helix	191	1
α-helix	198-218	21
α-helix	223-225	3
β-strand	227-228	2	1
α-helix	230-232	3
α-helix	245-257	13
β-strand	266-269	4	1
α-helix	276-288	13
β-strand	296-301	6	1
α-helix	303-313	11
α-helix	317-319	3
α-helix	320-337	18
α-helix	360-362	3

Chain B: 18 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	9-22	14
β-strand	28-32	5	5
α-helix	36-44	9
α-helix	52-63	12
α-helix	67-69	3
β-strand	73-78	6	5
α-helix	80-83	4
β-strand	86	1	6
β-strand	92	1	6
α-helix	93-99	7
α-helix	102	1
β-strand	103-107	5	5
β-strand	112-114	3	7
β-strand	122-124	3	7
α-helix	130-139	10
β-strand	144-151	8	5
β-strand	154	1	8
β-strand	157	1	8
α-helix	160-179	20
β-strand	183-190	8	5
α-helix	198-218	21
α-helix	223-225	3
β-strand	227-228	2	5
α-helix	230-232	3
α-helix	245-257	13
β-strand	266-269	4	5
α-helix	276-288	13
β-strand	296-301	6	5
α-helix	303-313	11
α-helix	317-319	3
α-helix	320-337	18
α-helix	360-362	3

Chain D: 17 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	9-22	14
β-strand	28-32	5	13
α-helix	36-44	9
α-helix	52-63	12
α-helix	67-69	3
β-strand	73-78	6	13
α-helix	80-83	4
β-strand	86	1	14
β-strand	92	1	14
α-helix	93-99	7
α-helix	102	1
β-strand	103-107	5	13
β-strand	112-114	3	15
β-strand	122-124	3	15
α-helix	130-139	10
β-strand	142-151	10	13
α-helix	160-179	20
β-strand	183-190	8	13
α-helix	198-218	21
α-helix	223-225	3
β-strand	227-228	2	13
α-helix	230-232	3
α-helix	245-257	13
β-strand	266-269	4	13
α-helix	276-288	13
β-strand	296-301	6	13
α-helix	303-313	11
α-helix	317-319	3
α-helix	320-337	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Fructose-bisphosphate aldolase A	A, B, C, D	protein	363	Oryctolagus cuniculus	P00883 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>5TLZ_1 Fructose-bisphosphate aldolase A (chains A, B, C, D)
PHSHPALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQ
LLLTADDRVNPCIGGVILFHETLYQKADDGRPFPQVIKSKGGVVGIKVDKGVVPLAGTNG
ETTTQGLDGLSERCAQYKKDGADFAKWRCVLKIGEHTPSALAIMENANVLARYASICQQN
GIVPIVEPEILPDGDHDLKRCQYVTEKVLAAVYKALSDHHIYLEGTLLKPNMVTPGHACT
QKYSHEEIAMATVTALRRTVPPAVTGVTFLSGGQSEEEASINLNAINKCPLLKPWALTFS
YGRALQASALKAWGGKKENLKAAQEEYVKRALANSLACQGKYTPSGQAGAAASESLFISN
HAY

Ligands and cofactors

ID	Name	Formula	Copies
N26	naphthalene-2,6-diyl bis[dihydrogen (phosphate)]	C10 H10 O8 P2	4

Water and common crystallization additives (GOL) are not listed.

Primary citation

Bisphosphonate Inhibitors of Mammalian Glycolytic Aldolase. Heron, P.W., Abellan-Flos, M., Salmon, L. et al. J Med Chem (2018) 61:10558-10572. DOI 10.1021/acs.jmedchem.8b01000 · PubMed

Other PDB entries of the same protein (UniProt P00883 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5TLE 1.58 Å, Fructose-1,6-bisphosphate aldolase from rabbit muscle in complex with the inhibitor…
3BV4 1.7 Å, Crystal structure of a rabbit muscle fructose-1,6-bisphosphate aldolase A dimer variant
1ZAI 1.76 Å, Fructose-1,6-bisphosphate Schiff base intermediate in FBP aldolase from rabbit muscle
1ZAH 1.8 Å, Fructose-1,6-bisphosphate aldolase from rabbit muscle
3DFQ 1.82 Å, D33S mutant fructose-1,6-bisphosphate aldolase from rabbit muscle
5F4X 1.84 Å, Fructose-1,6-bisphosphate aldolase K229M mutant from rabbit muscle
3DFN 1.86 Å, D33N mutant fructose-1,6-bisphosphate aldolase from rabbit muscle
2QUT 1.88 Å, Dihydroxyacetone phosphate enamine intermediate in fructose-1,6-bisphosphate aldolase…
1ZAJ 1.89 Å, Fructose-1,6-bisphosphate aldolase from rabbit muscle in complex with…
1ZAL 1.89 Å, Fructose-1,6-bisphosphate aldolase from rabbit muscle in complex with partially…
1ADO 1.9 Å, Fructose 1,6-bisphosphate aldolase from rabbit muscle
3DFO 1.94 Å, Dihydroxyacetone phosphate Schiff base and enamine intermediates in D33N mutant…

Browse structure collections

About this viewer

MolViewer shows 5TLZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.