5TPT: Amyloid-like protein 2

The Crystal Structure of Amyloid Precursor-Like Protein 2 (APLP2) E2 Domain. Determined by X-ray diffraction at 2.42 Å resolution. Released 6 Jun 2018.

Method: X-ray diffraction
Resolution: 2.42 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,244
Mol. weight: 47.06 kDa
Released: 6 Jun 2018

Explore 5TPT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5TPT contains 15 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	374-377	4
α-helix	386-417	32
α-helix	424-480	57
α-helix	484-485	2
α-helix	486-517	32
α-helix	519-545	27
α-helix	546-549	4
α-helix	551-556	6
α-helix	558-566	9

Chain B: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	388-417	30
α-helix	424-479	56
α-helix	486-517	32
α-helix	519-545	27
α-helix	551-556	6
α-helix	558-565	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Amyloid-like protein 2	A, B	protein	197	Homo sapiens	Q06481 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5TPT_1 Amyloid-like protein 2 (chains A, B)
DVDVYFETSADDNEHARFQKAKEQLEIRHRNRMDRVKKEWEEAELQAKNLPKAERQTLIQ
HFQAMVKALEKEAASEKQQLVETHLARVEAMLNDRRRMALENYLAALQSDPPRPHRILQA
LRRYVRAENKDRLHTIRHYQHVLAVDPEKAAQMKSQVMTHLHVIEERRNQSLSLLYKVPY
VAQEIQEEIDELLQEQR

Primary citation

The crystal structure of amyloid precursor-like protein 2 E2 domain completes the amyloid precursor protein family. Roisman, L.C., Han, S., Chuei, M.J. et al. FASEB J (2019) 33:5076-5081. DOI 10.1096/fj.201802315R · PubMed

Other PDB entries of the same protein (UniProt Q06481 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5JBT 1.4 Å, Mesotrypsin in complex with cleaved amyloid precursor like protein 2 inhibitor (APLP2)
8RQ6 Solution NMR structure of Amyloid beta precursor like protein 2 TMD

Browse structure collections

About this viewer

MolViewer shows 5TPT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.