5TTW: EED

Crystal Structure of EED in Complex with UNC4859. Determined by X-ray diffraction at 1.74 Å resolution. Released 11 Jan 2017.

Method: X-ray diffraction
Resolution: 1.74 Å
Organisms: Homo sapiens, synthetic construct
Chains: 4
Atoms: 6,726
Mol. weight: 86.17 kDa
Released: 11 Jan 2017

Explore 5TTW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5TTW contains 13 α-helices and 58 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 29 β-strands

Element	Residues	Length	Sheet
β-strand	82-89	8	1
β-strand	96-101	6	2
α-helix	106	1
α-helix	110	1
β-strand	111-117	7	2
β-strand	120-126	7	2
α-helix	128-130	3
β-strand	132-139	8	2
β-strand	147-154	8	3
β-strand	161-167	7	3
β-strand	171-176	6	3
β-strand	181-187	7	3
β-strand	193-198	6	4
β-strand	205-210	6	4
β-strand	215-219	5	4
β-strand	224-229	6	4
β-strand	239-244	6	5
β-strand	250-255	6	5
β-strand	260-264	5	5
α-helix	268-279	12
α-helix	282-284	3
α-helix	287-291	5
β-strand	292-294	3	4
β-strand	299-301	3	5
β-strand	311-315	5	6
β-strand	318-322	5	6
β-strand	327-333	7	6
α-helix	340-342	3
β-strand	350-357	8	6
β-strand	369-370	2	7
β-strand	376-380	5	7
β-strand	386-390	5	7
α-helix	396-398	3
β-strand	400-404	5	7
α-helix	412	1
β-strand	413-418	6	1
β-strand	424-429	6	1
β-strand	433-439	7	1

Chain C: 4 helices, 29 β-strands

Element	Residues	Length	Sheet
β-strand	82-89	8	8
β-strand	96-101	6	9
β-strand	111-117	7	9
β-strand	120-126	7	9
β-strand	132-139	8	9
β-strand	147-154	8	10
β-strand	161-167	7	10
β-strand	172-176	5	10
β-strand	181-186	6	10
β-strand	193-198	6	11
β-strand	205-210	6	11
β-strand	215-219	5	11
β-strand	224-229	6	11
β-strand	239-244	6	12
β-strand	250-255	6	12
β-strand	260-264	5	12
α-helix	268-279	12
α-helix	291	1
β-strand	292-294	3	11
β-strand	299-301	3	12
β-strand	311-315	5	6
β-strand	318-322	5	6
β-strand	327-333	7	6
α-helix	340-342	3
β-strand	350-357	8	6
β-strand	369-370	2	13
β-strand	376-380	5	13
β-strand	386-390	5	13
β-strand	401-404	4	13
α-helix	412	1
β-strand	413-418	6	8
β-strand	424-429	6	8
β-strand	433-439	7	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Polycomb protein EED	A, C	protein	367	Homo sapiens	O75530 (AlphaFold model)
UNC4859	B, D	protein	5	synthetic construct

Sequence of entity 1 (A, C), FASTA

>5TTW_1 Polycomb protein EED (chains A, C)
GKKCKYSFKCVNSLKEDHNQPLFGVQFNWHSKEGDPLVFATVGSNRVTLYECHSQGEIRL
LQSYVDADADENFYTCAWTYDSNTSHPLLAVAGSRGIIRIINPITMQCIKHYVGHGNAIN
ELKFHPRDPNLLLSVSKDHALRLWNIQTDTLVAIFGGVEGHRDEVLSADYDLLGEKIMSC
GMDHSLKLWRINSKRMMNAIKESYDYNPNKTNRPFISQKIHFPDFSTRDIHRNYVDCVRW
LGDLILSKSCENAIVCWKPGKMEDDIDKIKPSESNVTILGRFDYSQCDIWYMRFSMDFWQ
KMLALGNQVGKLYVWDLEVEDPHKAKCTTLTHHKCGAAIRQTSFSRDSSILIAVCDDASI
WRWDRLR

Sequence of entity 2 (B, D), FASTA

>5TTW_2 UNC4859 (chains B, D)
PSKFL

Primary citation

Discovery of Peptidomimetic Ligands of EED as Allosteric Inhibitors of PRC2. Barnash, K.D., The, J., Norris-Drouin, J.L. et al. ACS Comb Sci (2017) 19:161-172. DOI 10.1021/acscombsci.6b00174 · PubMed

Other PDB entries of the same protein (UniProt O75530 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5U69 1.28 Å, Polycomb protein EED in complex with inhibitor: (3R,4S)-1-[(2-methoxyphenyl)methyl]-N,N-d…
5U8F 1.34 Å, Polycomb protein EED in complex with inhibitor: (3R,4S)-1-[(1S)-7-fluoro-2,3-dihydro-1H-i…
5U8A 1.45 Å, Polycomb protein EED in complex with inhibitor: (3R,4S)-1-[(2-bromo-6-fluorophenyl)methyl…
6SFB 1.52 Å, EED in complex with a triazolopyrimidine
3K26 1.58 Å, Complex structure of EED and trimethylated H3K4
5U5T 1.6 Å, Crystal structure of EED in complex with H3K27Me3 peptide and…
7QK4 1.6 Å, EED in complex with PRC2 allosteric inhibitor compound 22 (MAK683)
7P3C 1.61 Å, EED in complex with compound 4
6V3Y 1.63 Å, Crystal structure of EED in complex with PALI1-K1219me3 peptide
5U6D 1.64 Å, Polycomb protein EED in complex with inhibitor: 2-[4-(4-{(3S,4R)-4-(dimethylamino)-1-[(2-…
6V3X 1.7 Å, Crystal structure of EED in complex with PALI1-K1241me3 peptide
7SI5 1.75 Å, Crystal structure of eed with mrtx-1919

Browse structure collections

About this viewer

MolViewer shows 5TTW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.