5TWF: MOB kinase activator 1A

Regulation of protein interactions by MOB1 phosphorylation. Determined by X-ray diffraction at 3.14 Å resolution. Released 12 Apr 2017.

Method: X-ray diffraction
Resolution: 3.14 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,956
Mol. weight: 50.36 kDa
Ligands: ZN
Released: 12 Apr 2017

Explore 5TWF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5TWF contains 24 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	25-34	10
α-helix	35-38	4
α-helix	41-44	4
α-helix	47-48	2
α-helix	53-74	22
α-helix	76-78	3
β-strand	87-88	2	1
β-strand	94-95	2	1
β-strand	97	1	2
β-strand	107	1	2
α-helix	111-126	16
α-helix	139-141	3
α-helix	146-164	19
α-helix	167-171	5
α-helix	177-193	17
α-helix	205-210	6

Chain B: 12 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	24-34	11
α-helix	35-38	4
α-helix	47-48	2
α-helix	53-74	22
β-strand	88	1	3
β-strand	94	1	3
β-strand	96-97	2	4
β-strand	107-108	2	4
α-helix	111-126	16
α-helix	138-141	4
α-helix	144-164	21
α-helix	167-172	6
α-helix	177-193	17
α-helix	198-201	4
α-helix	202-204	3
α-helix	205-208	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
MOB kinase activator 1A	A, B	protein	216	Homo sapiens	Q9H8S9 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5TWF_1 MOB kinase activator 1A (chains A, B)
MSFLFSSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRQAVMLPEGEDLNEWIAVN
TVDFFNQINMLYGTITEFCTEASCPVMSAGPRYEYHWADGTNIKKPIKCSAPKYIDYLMT
WVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDSVMQLEEEAHLN
TSFKHFIFFVQEFNLIDRRELAPLQELIEKLGSKDR

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2

Primary citation

Regulation of Protein Interactions by Mps One Binder (MOB1) Phosphorylation. Xiong, S., Couzens, A.L., Kean, M.J. et al. Mol Cell Proteomics (2017) 16:1111-1125. DOI 10.1074/mcp.M117.068130 · PubMed

Other PDB entries of the same protein (UniProt Q9H8S9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4J1V 1.95 Å, Functional and structural studies of MOBKL1B, a Salvador/Warts/Hippo tumor suppressor…
1PI1 2.0 Å, Crystal structure of a human Mob1 protein; toward understanding Mob-regulated cell cycle…
4JIZ 2.1 Å, Human Mob1-phosphopeptide complex
5XQZ 2.1 Å, Structure of the MOB1-NDR2 complex
5BRK 2.3 Å, pMob1-Lats1 complex
5TWG 2.3 Å, human MOB1A bound to human MST1 phosphorylated T353 peptide
5TWH 2.5 Å, human MOB1A bound to MST1 phosphorylated T367 peptide
6MCP 2.5 Å, L. pneumophila effector kinase LegK7 (AMP-PNP bound) in complex with human MOB1A
6MCQ 2.57 Å, L. pneumophila effector kinase LegK7 in complex with human MOB1A
5BRM 2.65 Å, Structural basis for Mob1-dependent activation of the core Mst-Lats kinase cascade in…

Browse structure collections

About this viewer

MolViewer shows 5TWF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.