Polycomb protein EED in complex with inhibitor: 2-[4-(4-{(3S,4R)-4-(dimethylamino)-1-[(2-fluoro-6-methylphenyl)methyl]pyrrolidin-3-yl}phenyl)-1H-pyrazol-1-yl]acetamide. Determined by X-ray diffraction at 1.64 Å resolution. Released 15 Mar 2017.
Explore 5U6D in 3D Show helices and sheets RCSB PDB PDBe
5U6D contains 8 α-helices and 29 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 83-89 | 7 | 1 |
| β-strand | 96-101 | 6 | 2 |
| α-helix | 105-106 | 2 | |
| α-helix | 110 | 1 | |
| β-strand | 111-117 | 7 | 2 |
| β-strand | 120-126 | 7 | 2 |
| β-strand | 132-139 | 8 | 2 |
| β-strand | 147-154 | 8 | 3 |
| β-strand | 161-167 | 7 | 3 |
| β-strand | 171-176 | 6 | 3 |
| β-strand | 181-187 | 7 | 3 |
| β-strand | 193-198 | 6 | 4 |
| β-strand | 205-210 | 6 | 4 |
| β-strand | 215-219 | 5 | 4 |
| β-strand | 224-229 | 6 | 4 |
| β-strand | 239-244 | 6 | 5 |
| β-strand | 250-255 | 6 | 5 |
| β-strand | 260-264 | 5 | 5 |
| α-helix | 268-279 | 12 | |
| α-helix | 282-284 | 3 | |
| α-helix | 288-291 | 4 | |
| β-strand | 292-294 | 3 | 4 |
| β-strand | 299-301 | 3 | 5 |
| β-strand | 311-315 | 5 | 6 |
| β-strand | 318-322 | 5 | 6 |
| β-strand | 327-333 | 7 | 6 |
| α-helix | 340-342 | 3 | |
| β-strand | 350-357 | 8 | 6 |
| β-strand | 368-370 | 3 | 7 |
| β-strand | 376-380 | 5 | 7 |
| β-strand | 386-390 | 5 | 7 |
| α-helix | 396-398 | 3 | |
| α-helix | 399 | 1 | |
| β-strand | 400-404 | 5 | 7 |
| β-strand | 413-418 | 6 | 1 |
| β-strand | 424-429 | 6 | 1 |
| β-strand | 433-438 | 6 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Polycomb protein EED | A | protein | 369 | Homo sapiens | O75530 (AlphaFold model) |
>5U6D_1 Polycomb protein EED (chains A) GSHMKCKYSFKCVNSLKEDHNQPLFGVQFNWHSKEGDPLVFATVGSNRVTLYECHSQGEI RLLQSYVDADADENFYTCAWTYDSNTSHPLLAVAGSRGIIRIINPITMQCIKHYVGHGNA INELKFHPRDPNLLLSVSKDHALRLWNIQTDTLVAIFGGVEGHRDEVLSADYDLLGEKIM SCGMDHSLKLWRINSKRMMNAIKESYDYNPNKTNRPFISQKIHFPDFSTRDIHRNYVDCV RWLGDLILSKSCENAIVCWKPGKMEDDIDKIKPSESNVTILGRFDYSQCDIWYMRFSMDF WQKMLALGNQVGKLYVWDLEVEDPHKAKCTTLTHHKCGAAIRQTSFSRDSSILIAVCDDA SIWRWDRLR
| ID | Name | Formula | Copies |
|---|---|---|---|
| 7XG | 2-[4-(4-{(3S,4R)-4-(dimethylamino)-1-[(2-fluoro-6-methylphenyl)methyl]pyrrolidi… | C25 H30 F N5 O | 1 |
SAR of amino pyrrolidines as potent and novel protein-protein interaction inhibitors of the PRC2 complex through EED binding. Curtin, M.L., Pliushchev, M.A., Li, H.Q. et al. Bioorg Med Chem Lett (2017) 27:1576-1583. DOI 10.1016/j.bmcl.2017.02.030 · PubMed
Other PDB entries of the same protein (UniProt O75530 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5U6D directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.