5U6K: TopBP1 BRCT4/5

Crystal structure of TopBP1 BRCT4/5 in complex with a BLM phosphopeptide. Determined by X-ray diffraction at 2.6 Å resolution. Released 4 Oct 2017.

Method: X-ray diffraction
Resolution: 2.6 Å
Organisms: Mus musculus, Homo sapiens
Chains: 12
Atoms: 11,899
Mol. weight: 179.71 kDa
Released: 4 Oct 2017

Explore 5U6K in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5U6K contains 91 α-helices and 85 β-strands across 12 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	560-563	4	1
α-helix	568-579	12
β-strand	584-585	2	1
α-helix	586-587	2
β-strand	596-599	4	1
β-strand	612-615	4	1
α-helix	616-625	10
α-helix	631-633	3
α-helix	635-637	3
α-helix	639-641	3
β-strand	653-656	4	2
α-helix	661-673	13
β-strand	677-678	2	2
β-strand	682	1	3
β-strand	687	1	4
α-helix	688-690	3
β-strand	692	1	4
β-strand	697-699	3	2
α-helix	706-713	8
β-strand	718-719	2	2
α-helix	721-730	10
α-helix	733-735	3
α-helix	736-739	4
β-strand	740	1	2

Chain B: 11 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	560-563	4	5
α-helix	568-579	12
β-strand	584-585	2	5
α-helix	586-587	2
β-strand	596-599	4	5
β-strand	612-615	4	5
α-helix	616-625	10
α-helix	631-633	3
α-helix	635-637	3
α-helix	639-641	3
β-strand	653-656	4	6
α-helix	662-673	12
β-strand	677-678	2	6
β-strand	682	1	7
β-strand	697-699	3	6
α-helix	706-713	8
β-strand	718-719	2	6
α-helix	721-730	10
α-helix	733-735	3
α-helix	736-739	4
β-strand	740	1	6

Chain C: 12 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	560-563	4	8
α-helix	568-579	12
β-strand	584-585	2	8
α-helix	586-587	2
β-strand	596-599	4	8
β-strand	612-615	4	8
α-helix	616-625	10
α-helix	631-633	3
α-helix	635-637	3
α-helix	639-641	3
β-strand	653-656	4	9
α-helix	662-673	12
β-strand	677-678	2	9
β-strand	682	1	10
β-strand	687	1	11
β-strand	692	1	11
α-helix	693-695	3
β-strand	697-699	3	9
α-helix	706-713	8
β-strand	718-719	2	9
α-helix	721-730	10
α-helix	733-735	3
α-helix	736-739	4
β-strand	740	1	9

Chain D: 10 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	560-563	4	12
α-helix	568-579	12
β-strand	584-585	2	12
β-strand	596-599	4	12
β-strand	612-615	4	12
α-helix	616-625	10
α-helix	631-633	3
α-helix	635-637	3
α-helix	639-641	3
β-strand	653-656	4	13
α-helix	661-673	13
β-strand	677-678	2	13
β-strand	682	1	14
β-strand	697-699	3	13
α-helix	706-713	8
β-strand	718-719	2	13
α-helix	721-730	10
α-helix	733-735	3
α-helix	736-739	4
β-strand	740	1	13

Chain E: 11 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	560-563	4	15
α-helix	568-579	12
β-strand	584-585	2	15
α-helix	586-587	2
β-strand	594-599	6	15
β-strand	610-615	6	15
α-helix	616-624	9
α-helix	631-633	3
α-helix	635-637	3
α-helix	639-641	3
β-strand	653-656	4	16
α-helix	662-673	12
β-strand	677-678	2	16
β-strand	683	1	17
β-strand	697-699	3	16
α-helix	706-713	8
β-strand	718-719	2	16
α-helix	721-730	10
α-helix	733-735	3
α-helix	736-739	4
β-strand	740	1	16

Chain F: 10 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	560-563	4	18
α-helix	568-580	13
β-strand	584-585	2	18
β-strand	594-599	6	18
β-strand	610-615	6	18
α-helix	616-625	10
α-helix	631-633	3
α-helix	635-637	3
α-helix	639-641	3
β-strand	653-656	4	19
α-helix	662-673	12
β-strand	677-678	2	19
β-strand	697-699	3	19
α-helix	706-713	8
β-strand	718-719	2	19
α-helix	721-730	10
α-helix	733-735	3
α-helix	736-739	4
β-strand	740	1	19

Chain G: 11 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	560-563	4	20
α-helix	568-580	13
β-strand	584-585	2	20
α-helix	586-587	2
β-strand	594-599	6	20
β-strand	610-615	6	20
α-helix	616-625	10
α-helix	631-633	3
α-helix	635-637	3
α-helix	639-641	3
β-strand	653-656	4	21
α-helix	662-673	12
β-strand	677-678	2	21
β-strand	697-699	3	21
α-helix	706-713	8
β-strand	718-719	2	21
α-helix	721-730	10
α-helix	733-735	3
α-helix	736-739	4
β-strand	740	1	21

Chain H: 10 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	560-563	4	22
α-helix	568-579	12
β-strand	584-585	2	22
β-strand	594-599	6	22
β-strand	610-615	6	22
α-helix	616-625	10
α-helix	631-633	3
α-helix	635-637	3
α-helix	639-641	3
β-strand	654-656	3	23
α-helix	662-673	12
β-strand	697-699	3	23
α-helix	706-713	8
β-strand	718-719	2	23
α-helix	721-730	10
α-helix	733-735	3
α-helix	736-739	4
β-strand	740	1	23

3 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA topoisomerase 2-binding protein 1	A, B, C, D, E, F, G, H	protein	200	Mus musculus	Q6ZQF0 (AlphaFold model)
Bloom Sydrome recQ helicase like protein (BLM)	L, M, N, O	protein	13	Homo sapiens	P54132 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F, G, H), FASTA

>5U6K_1 DNA topoisomerase 2-binding protein 1 (chains A, B, C, D, E, F, G, H)
GPLGSMEGLFSQKSFLVLGFSVENKCNIVDIIREHAGKIVSLPSRIVADYAVVPLLGCEV
DVTVGEVVTNTWLVTCIDNQTLVDPKSNPLFTPVSVMSGVTPLEDCVISFSQCVGAERDS
LVFLANHLGASVQEFFVRKANAKKGMLASTHLIVKEPTGSKYEAAKKWSLPAVNISWLLE
TARIGKRADENHFLVDNAPK

Sequence of entity 2 (L, M, N, O), FASTA

>5U6K_2 Bloom Sydrome recQ helicase like protein (BLM) (chains L, M, N, O)
DTDFVPPSPEEII

Primary citation

Structural Insight into BLM Recognition by TopBP1. Sun, L., Huang, Y., Edwards, R.A. et al. Structure (2017) 25:1582-1588.e3. DOI 10.1016/j.str.2017.08.005 · PubMed

Browse structure collections

About this viewer

MolViewer shows 5U6K directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.