5UEN: Human adenosine A1 receptor A1AR-bRIL

Crystal structure of the human adenosine A1 receptor A1AR-bRIL in complex with the covalent antagonist DU172 at 3.2A resolution. Determined by X-ray diffraction at 3.2 Å resolution. Released 1 Mar 2017.

Method: X-ray diffraction
Resolution: 3.2 Å
Organisms: Homo sapiens, Escherichia coli
Chains: 2
Atoms: 6,250
Mol. weight: 96.14 kDa
Ligands: DU1, OLA
Released: 1 Mar 2017

Explore 5UEN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5UEN contains 43 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 22 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	7-36	30
α-helix	38-40	3
α-helix	43-57	15
α-helix	58-62	5
α-helix	63-71	9
β-strand	75-76	2	1
α-helix	77-110	34
α-helix	115-118	4
α-helix	121-144	24
β-strand	147	1	2
α-helix	149-159	11
α-helix	165	1
β-strand	166-167	2	1
α-helix	171-174	4
β-strand	175	1	2
α-helix	177-178	2
α-helix	179-189	11
α-helix	190-1012	34
α-helix	1027-1039	13
α-helix	1057-1081	25
α-helix	1084-1097	14
α-helix	1098-1102	5
α-helix	1103-259	44
α-helix	267-291	25
α-helix	293-306	14
α-helix	310-315	6

Chain B: 21 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	7-36	30
α-helix	38-40	3
α-helix	43-57	15
α-helix	58-62	5
α-helix	63-71	9
β-strand	75-76	2	3
α-helix	77-110	34
α-helix	115-118	4
α-helix	121-144	24
β-strand	147	1	4
α-helix	149-159	11
α-helix	165	1
β-strand	166-167	2	3
α-helix	171-174	4
β-strand	175	1	4
α-helix	177-178	2
α-helix	179-189	11
α-helix	190-1018	40
α-helix	1023-1041	19
α-helix	1063-1081	19
α-helix	1084-1097	14
α-helix	1098-1102	5
α-helix	1103-259	44
α-helix	267-291	25
α-helix	293-306	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Adenosine receptor A1,Soluble cytochrome b562,Adenosine receptor A1	A, B	protein	416	Homo sapiens, Escherichia coli	P0ABE7 (AlphaFold model), P30542 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5UEN_1 Adenosine receptor A1,Soluble cytochrome b562,Adenosine receptor A1 (chains A, B)
GPPPSISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVG
ALVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKMVV
TPRRAAVAIAGCWILSFVVGLTPMFGWNNLSAVERAWAAAGSMGEPVIKCEFEKVISMEY
MVYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLADLEDNWETLNDNLKVIEKADNAAQVKD
ALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQ
AAAEQLKTTRNAYIQKYLERARSTLQKELKIAKSLALILFLFALSWLPLHILNCITLFCP
SCHKPSILTYIAIFLTHGNSAMNPIVYAFRIQKFRVTFLKIWNDHFRCQPLEVLFQ

Ligands and cofactors

ID	Name	Formula	Copies
DU1	4-{[3-(8-cyclohexyl-2,6-dioxo-1-propyl-1,2,6,7-tetrahydro-3H-purin-3-yl)propyl]…	C24 H30 F N5 O5 S	2
OLA	Oleic acid	C18 H34 O2	7

Primary citation

Structure of the Adenosine A1 Receptor Reveals the Basis for Subtype Selectivity. Glukhova, A., Thal, D.M., Nguyen, A.T. et al. Cell (2017) 168:867-877.e13. DOI 10.1016/j.cell.2017.01.042 · PubMed

Other PDB entries of the same protein (UniProt P0ABE7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6DYF 1.1 Å, Cu(II)-bound structure of the engineered cyt cb562 variant, CH3Y
5YO6 1.2 Å, Crystal Structure of B562RIL with engineered disulfide bond T9C-A36C
4JEA 1.22 Å, Crystal structure of an engineered Zn-RIDC1 construct with four interfacial disulfide…
7LSJ 1.26 Å, Cu-bound crystal structure of the engineered cyt cb562 variant, DiCyt2 - H63A,…
7MK4 1.27 Å, Co-bound crystal structure of the engineered cyt cb562 variant, DiCyt2
6DYC 1.33 Å, Co(II)-bound structure of the engineered cyt cb562 variant, CH3
5YO4 1.37 Å, Crystal Structure of B562RIL with engineered disulfide bond K27C-A79C
256B 1.4 Å, Improvement of the 2.5 Å resolution model of cytochrome B562 by redetermining the…
6OT4 1.4 Å, Bimetallic dodecameric cage design 2 (BMC2) from cytochrome cb562
7LRV 1.4 Å, Ni-bound crystal structure of the engineered cyt cb562 variant, DiCyt2, crystallized in…
9PQ4 1.48 Å, Bi-bound structure of the H77C variant of TriCyt2
6DYG 1.49 Å, Fe(II)-bound structure of the engineered cyt cb562 variant, CH3Y

Browse structure collections

About this viewer

MolViewer shows 5UEN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.