5UFS: Ancestral Glucocorticoid Receptor2

X-Ray Crystal Structure of the Ancestral Glucocorticoid Receptor 2 ligand binding domain in complex with triamcinolone acetonide and SHP coregulator fragment. Determined by X-ray diffraction at 2.12 Å resolution. Released 26 Apr 2017.

Method: X-ray diffraction
Resolution: 2.12 Å
Organisms: unidentified, Homo sapiens
Chains: 4
Atoms: 4,339
Mol. weight: 60.25 kDa
Ligands: 1TA
Released: 26 Apr 2017

Explore 5UFS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5UFS contains 24 α-helices and 8 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 11 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	1-8	8
α-helix	10-14	5
α-helix	25-49	25
α-helix	53-55	3
α-helix	58-85	28
β-strand	90-93	4	1
β-strand	96-98	3	1
α-helix	109-125	17
α-helix	129-140	12
β-strand	143-145	3	2
α-helix	152-171	20
α-helix	177-210	34
α-helix	212-214	3
α-helix	220-234	15
β-strand	238-240	3	2

Chain C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	19-26	8

Chain D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	19-25	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ancestral Glucocorticoid Receptor2	A, B	protein	248	unidentified	A0A1X8XLE9 (AlphaFold model)
SHP NR Box 1 Peptide	C, D	protein	11	Homo sapiens	Q15466 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5UFS_1 Ancestral Glucocorticoid Receptor2 (chains A, B)
APTLISLLEVIEPEVLYSGYDSTLPDTSTRLMSTLNRLGGRQVVSAVKWAKALPGFRNLH
LDDQMTLLQYSWMSLMAFSLGWRSYKQSNGNMLCFAPDLVINEERMQLPYMYDQCQQMLK
ISSEFVRLQVSYDEYLCMKVLLLLSTVPKDGLKSQAVFDEIRMTYIKELGKAIVKREGNS
SQNWQRFYQLTKLLDSMHEMVGGLLQFCFYTFVNKSLSVEFPEMLAEIISNQLPKFKAGS
VKPLLFHQ

Sequence of entity 2 (C, D), FASTA

>5UFS_2 SHP NR Box 1 Peptide (chains C, D)
APAILYALLSS

Ligands and cofactors

ID	Name	Formula	Copies
1TA	Triamcinolone acetonide	C24 H31 F O6	2

Primary citation

Structural Analysis of the Glucocorticoid Receptor Ligand-Binding Domain in Complex with Triamcinolone Acetonide and a Fragment of the Atypical Coregulator, Small Heterodimer Partner. Weikum, E.R., Okafor, C.D., D'Agostino, E.H. et al. Mol Pharmacol (2017) 92:12-21. DOI 10.1124/mol.117.108506 · PubMed

Other PDB entries of the same protein (UniProt A0A1X8XLE9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6W9L 1.45 Å, Structure of the Ancestral Glucocorticoid Receptor 2 ligand binding domain in complex…
6W9M 1.59 Å, Structure of the Ancestral Glucocorticoid Receptor 2 ligand binding domain in complex…
6W9K 1.6 Å, Structure of the Ancestral Glucocorticoid Receptor 2 ligand binding domain in complex…
7YXC 2.25 Å, Crystal structure of WT AncGR2-LBD bound to dexamethasone and SHP coregulator fragment
7YXD 2.3 Å, Crystal structure of WT AncGR2-LBD bound to dexamethasone and SHP coregulator fragment
7YXN 2.46 Å, Crystal structure of WT AncGR2-LBD bound to dexamethasone and SHP coregulator fragment
7YXR 2.5 Å, Crystal structure of mutant AncGR2-LBD (Y545A) bound to dexamethasone and SHP…
7YXO 2.99 Å, Crystal structure of WT AncGR2-LBD bound to dexamethasone and SHP coregulator fragment
7YXP 3.36 Å, Crystal structure of WT AncGR2-LBD WT bound to dexamethasone and SHP coregulator fragment

Browse structure collections

About this viewer

MolViewer shows 5UFS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.