5UIW: CC Chemokine Receptor 5

Crystal Structure of CC Chemokine Receptor 5 (CCR5) in complex with high potency HIV entry inhibitor 5P7-CCL5. Determined by X-ray diffraction at 2.2 Å resolution. Released 28 Jun 2017.

Method: X-ray diffraction
Resolution: 2.2 Å
Organisms: Homo sapiens, Clostridium pasteurianum
Chains: 2
Atoms: 3,443
Mol. weight: 58.59 kDa
Ligands: OLA, OLC, ZN
Released: 28 Jun 2017

Explore 5UIW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5UIW contains 25 α-helices and 14 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 20 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	18-19	2
β-strand	20	1	1
α-helix	21	1
α-helix	23-57	35
α-helix	64-91	28
α-helix	97-131	35
α-helix	136-139	4
α-helix	142-165	24
β-strand	167-172	6	2
β-strand	175-180	6	2
α-helix	184-186	3
α-helix	187-199	13
α-helix	200-204	5
α-helix	205-221	17
α-helix	1001-1003	3
β-strand	1004-1006	3	3
β-strand	1012-1013	2	3
β-strand	1019	1	4
α-helix	1020-1022	3
β-strand	1024	1	4
α-helix	1030-1032	3
β-strand	1038	1	5
β-strand	1045	1	5
α-helix	1046-1048	3
β-strand	1049-1051	3	3
α-helix	1053-259	35
α-helix	269-288	20
α-helix	289-291	3
α-helix	292-299	8
α-helix	302-313	12

Chain B: 5 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	5-7	3
β-strand	10	1	1
α-helix	18-20	3
α-helix	21-23	3
β-strand	24-29	6	6
α-helix	30-31	2
β-strand	39-43	5	6
β-strand	48-51	4	6
α-helix	56-66	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
C-C chemokine receptor type 5,Rubredoxin chimera	A	protein	411	Homo sapiens, Clostridium pasteurianum	P00268 (AlphaFold model), P51681 (AlphaFold model)
C-C motif chemokine 5	B	protein	75	Homo sapiens	P13501 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5UIW_1 C-C chemokine receptor type 5,Rubredoxin chimera (chains A)
GAPDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNMLVILILINY
KRLKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFF
IILLTIDRYLAVVHAVFALKARTVTFGVVTSVITWVVAVFASLPNIIFTRSQKEGLHYTC
SSHFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRMKKYTCTVCGYIYNP
EDGDPDNGVNPGTDFKDIPDDWVCPLCGVGKDQFEEVEEEKKRHRDVRLIFTIMIVYFLF
WAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFVGEEFRNY
LLVFFQKHIFCKCCSIFQQEAPERASSVYTRSTGEQEISVGLGRPLEVLFQ

Sequence of entity 2 (B), FASTA

>5UIW_2 C-C motif chemokine 5 (chains B)
QGPPLMALQSCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVR
EYINSLEMSLEVLFQ

Ligands and cofactors

ID	Name	Formula	Copies
OLA	Oleic acid	C18 H34 O2	2
OLC	(2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate	C21 H40 O4	6
ZN	Zinc ion	Zn	1

Primary citation

Structure of CC Chemokine Receptor 5 with a Potent Chemokine Antagonist Reveals Mechanisms of Chemokine Recognition and Molecular Mimicry by HIV. Zheng, Y., Han, G.W., Abagyan, R. et al. Immunity (2017) 46:1005-1017.e5. DOI 10.1016/j.immuni.2017.05.002 · PubMed

Other PDB entries of the same protein (UniProt P00268 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2PVE 0.79 Å, NMR and X-ray Analysis of Structural Additivity in Metal Binding Site-Swapped Hybrids of…
1IRO 1.1 Å, Rubredoxin (oxidized, fe(iii)) at 1.1 Å resolution
1IRN 1.2 Å, Rubredoxin (ZN-substituted) at 1.2 Å resolution
4RXN 1.2 Å, Crystallographic refinement of rubredoxin at 1.2 Å resolution
5RXN 1.2 Å, Combined crystallographic refinement and energy minimization of rubredoxin at 1.2 Å…
1SMM 1.36 Å, Crystal Structure of Cp Rd L41A mutant in oxidized state
1SMW 1.38 Å, Crystal Structure of Cp Rd L41A mutant in reduced state 2 (soaked)
1SMU 1.43 Å, Crystal Structure of Cp Rd L41A mutant in reduced state 1 (drop-reduced)
1B13 1.5 Å, Clostridium pasteurianum rubredoxin G10A mutant
1FHH 1.5 Å, X-ray crystal structure of oxidized rubredoxin
1FHM 1.5 Å, X-ray crystal structure of reduced rubredoxin
1R0I 1.5 Å, cadmium-substituted rubredoxin

Browse structure collections

About this viewer

MolViewer shows 5UIW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.