Crystal structure of N-terminal domain of human FACT complex subunit SPT16. Determined by X-ray diffraction at 2.09 Å resolution. Released 31 Jan 2018.
Explore 5UMT in 3D Show helices and sheets RCSB PDB PDBe
5UMT contains 27 α-helices and 27 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 2-4 | 3 | |
| α-helix | 7-23 | 17 | |
| α-helix | 26-28 | 3 | |
| β-strand | 33-38 | 6 | 1 |
| α-helix | 48-57 | 10 | |
| β-strand | 64-69 | 6 | 1 |
| β-strand | 73-77 | 5 | 1 |
| α-helix | 79-89 | 11 | |
| α-helix | 95-97 | 3 | |
| α-helix | 101-102 | 2 | |
| β-strand | 103-107 | 5 | 1 |
| α-helix | 115-126 | 12 | |
| β-strand | 133-136 | 4 | 1 |
| α-helix | 145-155 | 11 | |
| β-strand | 160-163 | 4 | 1 |
| α-helix | 165-173 | 9 | |
| α-helix | 175-176 | 2 | |
| α-helix | 177-193 | 17 | |
| α-helix | 194-198 | 5 | |
| α-helix | 199-208 | 10 | |
| β-strand | 213 | 1 | 2 |
| α-helix | 214-224 | 11 | |
| α-helix | 228-230 | 3 | |
| α-helix | 236-238 | 3 | |
| β-strand | 239-241 | 3 | 3 |
| β-strand | 246-248 | 3 | 4 |
| β-strand | 249 | 1 | 5 |
| β-strand | 252 | 1 | 5 |
| β-strand | 265 | 1 | 2 |
| α-helix | 266-267 | 2 | |
| β-strand | 270-275 | 6 | 4 |
| β-strand | 277-279 | 3 | 3 |
| β-strand | 282 | 1 | 3 |
| β-strand | 286-292 | 7 | 4 |
| α-helix | 296-315 | 20 | |
| β-strand | 317 | 1 | 6 |
| β-strand | 321 | 1 | 7 |
| α-helix | 322-336 | 15 | |
| α-helix | 338-340 | 3 | |
| β-strand | 344 | 1 | 4 |
| β-strand | 349-351 | 3 | 4 |
| α-helix | 359-361 | 3 | |
| β-strand | 362 | 1 | 4 |
| α-helix | 369 | 1 | |
| β-strand | 370 | 1 | 7 |
| α-helix | 371 | 1 | |
| β-strand | 376-387 | 12 | 4 |
| α-helix | 394-397 | 4 | |
| β-strand | 398-408 | 11 | 4 |
| β-strand | 410 | 1 | 6 |
| α-helix | 414-415 | 2 | |
| β-strand | 416-417 | 2 | 4 |
| α-helix | 425-428 | 4 | |
| β-strand | 429-430 | 2 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| FACT complex subunit SPT16 | A | protein | 434 | Homo sapiens | Q9Y5B9 (AlphaFold model) |
>5UMT_1 FACT complex subunit SPT16 (chains A) MAVTLDKDAYYRRVKRLYSNWRKGEDEYANVDAIVVSVGVDEEIVYAKSTALQTWLFGYE LTDTIMVFCDDKIIFMASKKKVEFLKQIANTKGNENANGAPAITLLIREKNESNKSSFDK MIEAIKESKNGKKIGVFSKDKFPGEFMKSWNDCLNKEGFDKIDISAVVAYTIAVKEDGEL NLMKKAASITSEVFNKFFKERVMEIVDADEKVRHSKLAESVEKAIEEKKYLAGADPSTVE MCYPPIIQSGGNYNLKFSVVSDKNHMHFGAITCAMGIRFKSYCSNLVRTLMVDPSQEVQE NYNFLLQLQEELLKELRHGVKICDVYNAVMDVVKKQKPELLNKITKNLGFGMGIEFREGS LVINSKNQYKLKKGMVFSINLGFSDLTNKEGKKPEEKTYALFIGDTVLVDEDGPATVLTS VKKKVKNVGIFLKN
Crystal structure of N-terminal domain of human FACT complex subunit SPT16. Hu, Q., Su, D., Thompson, J.R. et al. To be published.
Other PDB entries of the same protein (UniProt Q9Y5B9 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5UMT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.