5UMU: FACT complex subunit SPT16

Crystal structure of the middle double PH domain of human FACT complex subunit SPT16. Determined by X-ray diffraction at 1.9 Å resolution. Released 31 Jan 2018.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Homo sapiens
Chains: 2
Atoms: 4,899
Mol. weight: 68.06 kDa
Released: 31 Jan 2018

Explore 5UMU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5UMU contains 25 α-helices and 36 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	661-668	8	1
β-strand	677-682	6	1
β-strand	686-691	6	1
β-strand	696-700	5	1
α-helix	701-703	3
β-strand	704-710	7	1
β-strand	717-730	14	1
β-strand	733-743	11	1
α-helix	744-745	2
α-helix	770-790	21
β-strand	797-798	2	1
α-helix	799-800	2
α-helix	802-804	3
β-strand	806-808	3	2
β-strand	809	1	3
β-strand	815-817	3	2
β-strand	818-819	2	4
β-strand	823-826	4	4
β-strand	833-836	4	4
α-helix	837-839	3
β-strand	840-846	7	5
β-strand	854-861	8	5
α-helix	867-868	2
β-strand	869-875	7	5
α-helix	876-878	3
α-helix	879-888	10
β-strand	893-895	3	5
α-helix	899-900	2
α-helix	902-911	10
α-helix	913-918	6
α-helix	921-925	5

Chain B: 12 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	661-668	8	6
β-strand	677-682	6	6
β-strand	686-691	6	6
β-strand	696-700	5	6
α-helix	701-703	3
β-strand	704-710	7	6
β-strand	717-730	14	6
β-strand	733-743	11	6
α-helix	768-791	24
β-strand	797-798	2	6
α-helix	799-800	2
α-helix	802-804	3
β-strand	806-808	3	7
β-strand	809	1	8
β-strand	815-817	3	7
β-strand	818-819	2	9
β-strand	823-826	4	9
β-strand	833-836	4	9
α-helix	837-839	3
β-strand	840-846	7	10
β-strand	854-861	8	10
α-helix	867-868	2
β-strand	869-875	7	10
α-helix	876-878	3
α-helix	879-889	11
β-strand	893-895	3	10
α-helix	899-900	2
α-helix	902-911	10
α-helix	913-918	6
α-helix	921-925	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
FACT complex subunit SPT16	A, B	protein	283	Homo sapiens	Q9Y5B9 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5UMU_1 FACT complex subunit SPT16 (chains A, B)
GAMGSDSLVINLNRSNPKLKDLYIRPNIAQKRMQGSLEAHVNGFRFTSVRGDKVDILYNN
IKHALFQPCDGEMIIVLHFHLKNAIMFGKKRHTDVQFYTEVGEITTDLGKHQHMHDRDDL
YAEQMEREMRHKLKTAFKNFIEKVEALTKEELEFEVPFRDLGFNGAPYRSTCLLQPTSSA
LVNATEWPPFVVTLDEVELIHFERVQFHLKNFDMVIVYKDYSKKVTMINAIPVASLDPIK
EWLNSCDLKYTEGVQSLNWTKIMKTIVDDPEGFFEQGGWSFLE

Primary citation

Crystal structure of the middle double PH domain of human FACT complex subunit SPT16. Hu, Q., Su, D., Thompson, J.R. et al. To be published.

Other PDB entries of the same protein (UniProt Q9Y5B9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5E5B 1.84 Å, Crystal structure of Human Spt16 N-terminal domain
4Z2N 1.92 Å, Crystal structure of human FACT SPT16 middle domain
8I17 1.98 Å, Structural basis for H2A-H2B recognitions by human Spt16
5UMT 2.09 Å, Crystal structure of N-terminal domain of human FACT complex subunit SPT16
5XM2 2.19 Å, Human N-terminal domain of FACT complex subunit SPT16
4Z2M 2.98 Å, Crystal structure of human SPT16 Mid-AID/H3-H4 tetramer FACT Histone complex
9EH2 3.1 Å, RNA polymerase II-DSIF-SPT6-PAF1c-TFIIS-IWS1-SETD2-FACT nucleosome upstream
9RZC 3.66 Å, State 3 MAP 1 SETD2 bound to distal H3 of upstream nucleosome
8YJM 4.15 Å, Structure of human SPT16 MD-CTD and MCM2 HBD chaperoning a histone H3-H4 tetramer and a…
8YJF 4.4 Å, Structure of human SPT16 MD-CTD and MCM2 HBD chaperoning a histone H3-H4 tetramer and an…
9GW2 4.84 Å, State 2 MAP 1 SETD2 bound to proximal H3 of upstream nucleosome
6UPK 4.9 Å, Structure of FACT_subnucleosome complex 1

Browse structure collections

About this viewer

MolViewer shows 5UMU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.