Human Bfl-1 in complex with PUMA BH3. Determined by X-ray diffraction at 1.33 Å resolution. Released 21 Jun 2017.
Explore 5UUL in 3D Show helices and sheets RCSB PDB PDBe
5UUL contains 10 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 6-21 | 16 | |
| α-helix | 23-26 | 4 | |
| α-helix | 32-51 | 20 | |
| α-helix | 53-57 | 5 | |
| α-helix | 64-78 | 15 | |
| α-helix | 86-106 | 21 | |
| α-helix | 114-136 | 23 | |
| α-helix | 139-144 | 6 | |
| α-helix | 145-148 | 4 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 2-19 | 18 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Bcl-2-related protein A1 | A | protein | 152 | Homo sapiens | Q16548 (AlphaFold model) |
| Bcl-2-binding component 3 | B | protein | 25 | Homo sapiens | Q9BXH1 (AlphaFold model) |
>5UUL_1 Bcl-2-related protein A1 (chains A) GMTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKSCLDNV NVVSVDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEIS YFVAEFIMNNTGEWIRQNGGWENGFVKKFEPK
>5UUL_2 Bcl-2-binding component 3 (chains B) XQWAREIGAQLRRMADDLNAQYERX
Epistatic mutations in PUMA BH3 drive an alternate binding mode to potently and selectively inhibit anti-apoptotic Bfl-1. Jenson, J.M., Ryan, J.A., Grant, R.A. et al. Elife (2017) 6. DOI 10.7554/eLife.25541 · PubMed
Other PDB entries of the same protein (UniProt Q16548 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5UUL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.