BFL1 covalently bound to inhibitor compound 7. Determined by X-ray diffraction at 1.46 Å resolution. Released 18 Dec 2024.
Explore 9GIP in 3D Show helices and sheets RCSB PDB PDBe
9GIP contains 12 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 6-20 | 15 | |
| α-helix | 24-25 | 2 | |
| α-helix | 32-51 | 20 | |
| α-helix | 53-57 | 5 | |
| α-helix | 64-78 | 15 | |
| α-helix | 86-106 | 21 | |
| α-helix | 114-125 | 12 | |
| α-helix | 126-130 | 5 | |
| α-helix | 131-136 | 6 | |
| α-helix | 139 | 1 | |
| α-helix | 140-144 | 5 | |
| α-helix | 145-148 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Bcl-2-related protein A1 | A | protein | 152 | Homo sapiens | Q16548 (AlphaFold model) |
>9GIP_1 Bcl-2-related protein A1 (chains A) GMTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKSCLDNV NVVSVDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEIS YFVAEFIMNNTGEWIRQNGGWENGFVKKFEPK
| ID | Name | Formula | Copies |
|---|---|---|---|
| A1ILY | ~{N}-[4-[(1~{R},3~{R})-3-azanylcyclopentyl]oxyphenyl]-~{N}-[(1~{S})-1-(4-chloro… | C22 H27 Cl N2 O2 | 1 |
Structure-Based Discovery of a Series of Covalent, Orally Bioavailable, and Selective BFL1 Inhibitors. Palisse, A., Cheung, T., Blokhuis, A. et al. J Med Chem (2024) 67:22055-22079. DOI 10.1021/acs.jmedchem.4c01995 · PubMed
Other PDB entries of the same protein (UniProt Q16548 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 9GIP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.