5UWA: E. coli phospholipid binding protein MlaC

Structure of E. coli phospholipid binding protein MlaC. Determined by X-ray diffraction at 1.5 Å resolution. Released 12 Apr 2017.

Method: X-ray diffraction
Resolution: 1.5 Å
Organism: Escherichia coli (strain K12)
Chains: 2
Atoms: 3,516
Mol. weight: 48.25 kDa
Ligands: 8ND
Released: 12 Apr 2017

Explore 5UWA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5UWA contains 23 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	27-44	18
α-helix	46-51	6
α-helix	55-63	9
α-helix	65-67	3
β-strand	68	1	1
α-helix	70-78	9
α-helix	80-83	4
α-helix	87-109	23
β-strand	116-119	4	1
α-helix	120-122	3
β-strand	130-138	9	1
α-helix	144-145	2
β-strand	146-154	9	1
β-strand	161-168	8	1
β-strand	171-172	2	1
α-helix	173-180	8
α-helix	182-201	20
α-helix	204-205	2

Chain B: 11 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	27-44	18
α-helix	46-51	6
α-helix	55-63	9
α-helix	65-67	3
β-strand	68	1	2
α-helix	70-78	9
α-helix	81-84	4
α-helix	87-109	23
β-strand	116-119	4	2
α-helix	120-122	3
β-strand	130-138	9	2
α-helix	144-145	2
β-strand	146-154	9	2
β-strand	161-168	8	2
β-strand	171-172	2	2
α-helix	173-201	29
α-helix	204-205	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Probable phospholipid-binding protein MlaC	A, B	protein	203	Escherichia coli (strain K12)	P0ADV7 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5UWA_1 Probable phospholipid-binding protein MlaC (chains A, B)
MHHHHHHENLYFQADQTNPYKLMDEAAQKTFDRLKNEQPQIRANPDYLRTIVDQELLPYV
QVKYAGALVLGQYYKSATPAQREAYFAAFREYLKQAYGQALAMYHGQTYQIAPEQPLGDK
TIVPIRVTIIDPNGRPPVRLDFQWRKNSQTGNWQAYDMIAEGVSMITTKQNEWGTLLRTK
GIDGLTAQLKSISQQKITLEEKK

Ligands and cofactors

ID	Name	Formula	Copies
8ND	(2S)-3-(2-aminoethoxy)propane-1,2-diyl dihexadecanoate	C37 H73 N O5	2

Primary citation

Architectures of Lipid Transport Systems for the Bacterial Outer Membrane. Ekiert, D.C., Bhabha, G., Isom, G.L. et al. Cell (2017) 169:273-285.e17. DOI 10.1016/j.cell.2017.03.019 · PubMed

Other PDB entries of the same protein (UniProt P0ADV7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6GKI 2.23 Å, Structure of E coli MlaC in Variously Loaded States
7VR6 2.5 Å, Crystal structure of MlaC from Escherichia coli in quasi-open state
8I8X 3.25 Å, Cryo-EM Structure of OmpC3-MlaA-MlaC Complex in MSP2N2 Nanodiscs
8OJ4 4.35 Å, Structure of the MlaCD complex (1:6 stoichiometry)
8OJG 4.38 Å, Structure of the MlaCD complex (2:6 stoichiometry)

Browse structure collections

About this viewer

MolViewer shows 5UWA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.