5V2P: CaV beta2a subunit: CaV1.2 AID-CAP complex

CaV beta2a subunit: CaV1.2 AID-CAP complex. Determined by X-ray diffraction at 2.0 Å resolution. Released 19 Jul 2017.

Method: X-ray diffraction
Resolution: 2.0 Å
Organisms: Rattus norvegicus, Homo sapiens
Chains: 2
Atoms: 2,781
Mol. weight: 42.17 kDa
Ligands: NI, 8VY
Released: 19 Jul 2017

Explore 5V2P in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5V2P contains 16 α-helices and 13 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	85-106	22
α-helix	110-111	2
β-strand	113-117	5	1
β-strand	121	1	2
α-helix	125-127	3
β-strand	135	1	1
α-helix	136-137	2
β-strand	138	1	2
β-strand	143-149	7	1
β-strand	154-159	6	1
β-strand	167-170	4	1
α-helix	172-187	16
β-strand	271-274	4	1
α-helix	278-279	2
β-strand	280-283	4	3
α-helix	291-307	17
β-strand	312-317	6	3
α-helix	321-323	3
α-helix	346-361	16
β-strand	366-371	6	3
α-helix	377-380	4
β-strand	388-392	5	3
α-helix	397-406	10
α-helix	409-412	4
α-helix	415-426	12
α-helix	430-433	4
β-strand	436-438	3	3
α-helix	443-461	19

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	429-444	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Voltage-dependent L-type calcium channel subunit beta-2	A	protein	347	Rattus norvegicus	Q8VGC3 (AlphaFold model)
Voltage-dependent L-type calcium channel subunit alpha-1C	B	protein	19	Homo sapiens	Q13936 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5V2P_1 Voltage-dependent L-type calcium channel subunit beta-2 (chains A)
GSADSYTSRPSDSDVSSLEEDREAVRREAERQAQAQLEKAKTKPVAFAVRTNVRYSAAQE
DDVPVPGMAISFEAKDFLHVKEKFNNDWWIGRLVKEGCEIGFIPSPVKLENMRLQHEQRA
KQGSSKEKRMPFFKKTEHTPPYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFE
GRISITRVTADISLAKRSVLNNPSKHAIIERSNTRSSLAEVQSEIERIFELARTLQLVVL
DADTINHPAQLSKTSLAPIIVYVKISSPKVLQRLIKSRGKSQAKHLNVQMVAADKLAQCP
PQESFDVILDENQLEDACEHLADYLEAYWKATHPPSSNLPNPLLSRT

Sequence of entity 2 (B), FASTA

>5V2P_2 Voltage-dependent L-type calcium channel subunit alpha-1C (chains B)
CSPLECDLKGYLDWITQAE

Ligands and cofactors

ID	Name	Formula	Copies
NI	Nickel (II) ion	Ni	1
8VY	1,3-bis(bromomethyl)benzene	C8 H8 Br2	1

Water and common crystallization additives (1PE) are not listed.

Primary citation

Stapled Voltage-Gated Calcium Channel (CaV) alpha-Interaction Domain (AID) Peptides Act As Selective Protein-Protein Interaction Inhibitors of CaV Function. Findeisen, F., Campiglio, M., Jo, H. et al. ACS Chem Neurosci (2017) 8:1313-1326. DOI 10.1021/acschemneuro.6b00454 · PubMed

Other PDB entries of the same protein (UniProt Q8VGC3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5V2Q 1.7 Å, CaV beta2a subunit: CaV1.2 AID-CEN complex
1T0H 1.97 Å, Crystal structure of the Rattus norvegicus voltage gated calcium channel beta subunit…
1T0J 2.0 Å, Crystal structure of a complex between voltage-gated calcium channel beta2a subunit and…
3JBR 4.2 Å, Cryo-EM structure of the rabbit voltage-gated calcium channel Cav1.1 complex at 4.2…

Browse structure collections

About this viewer

MolViewer shows 5V2P directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.