5VNY: DM14-3 domain of Lgd

Crystal structure of DM14-3 domain of Lgd. Determined by X-ray diffraction at 1.1 Å resolution. Released 14 Jun 2017.

Method: X-ray diffraction
Resolution: 1.1 Å
Organism: Drosophila melanogaster
Chains: 1
Atoms: 632
Mol. weight: 7.43 kDa
Released: 14 Jun 2017

Explore 5VNY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5VNY contains 4 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	361-380	20
α-helix	385-406	22
α-helix	409-411	3
α-helix	413-415	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Lethal (2) giant discs 1, isoform B	A	protein	66	Drosophila melanogaster	Q9VKJ9 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5VNY_1 Lethal (2) giant discs 1, isoform B (chains A)
STNMLEALQQRLEKYQSVEAAAKAENNSGKARRFGRIVKQYEDAIKLYKAGKPVPYDELP
VPPGFG

Primary citation

Structural Basis for Regulation of ESCRT-III Complexes by Lgd. McMillan, B.J., Tibbe, C., Drabek, A.A. et al. Cell Rep (2017) 19:1750-1757. DOI 10.1016/j.celrep.2017.05.026 · PubMed

Other PDB entries of the same protein (UniProt Q9VKJ9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5VO5 2.0 Å, Crystal structure of Lgd-Shrub complex, single chain fusion
6EI6 2.46 Å, CC2D1B coordinates ESRCT-III activity during the mitotic reformation of the nuclear…
7ZSS 2.63 Å, cryo-EM structure of D614 spike in complex with de novo designed binder
7ZRV 2.8 Å, cryo-EM structure of omicron spike in complex with de novo designed binder, full map
7ZSD 3.29 Å, cryo-EM structure of omicron spike in complex with de novo designed binder, local

Browse structure collections

About this viewer

MolViewer shows 5VNY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.