5W3N: RNA-binding protein FUS

Name: PDB 5W3N: Molecular structure of FUS low sequence complexity domain protein fibrils
Published: 2017-09-27
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: protein fibril

Molecular structure of FUS low sequence complexity domain protein fibrils. Determined by solid-state NMR. Released 27 Sept 2017.

Method: Solid-state NMR
Organism: Homo sapiens
Chains: 9
Atoms: 3,987
Mol. weight: 223.83 kDa
Released: 27 Sept 2017

Explore 5W3N in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5W3N contains 0 α-helices and 81 β-strands across 9 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B, C, D, E, F, G, H and I: 0 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	38-40	3	1
β-strand	44-45	2	2
β-strand	52	1	3
β-strand	61-64	4	4
β-strand	67-70	4	5
β-strand	78	1	6
β-strand	84	1	7
β-strand	87	1	8
β-strand	93-95	3	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
RNA-binding protein FUS	A, B, C, D, E, F, G, H, I	protein	241	Homo sapiens	P35637 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F, G, H, I), FASTA

>5W3N_1 RNA-binding protein FUS (chains A, B, C, D, E, F, G, H, I)
MSYYHHHHHHDYDIPTTENLYFQGAMDPASNDYTQQATQSYGAYPTQPGQGYSQQSSQPY
GQQSYSGYSQSTDTSGYGQSSYSSYGQSQNTGYGTQSTPQGYGSTGGYGSSQSSQSSYGQ
QSSYPGYGQQPAPSSTSGSYGSSSQSSSYGQPQSGSYSQQPSYGGQQQSYGQQQSYNPPQ
GYGQQNQYNSSSGGGGGGGGGGNYGQDQSSMSSGGGSGGGYGNQDQSGGGGSGGYGQQDR
G

Primary citation

Structure of FUS Protein Fibrils and Its Relevance to Self-Assembly and Phase Separation of Low-Complexity Domains. Murray, D.T., Kato, M., Lin, Y. et al. Cell (2017) 171:615-627.e16. DOI 10.1016/j.cell.2017.08.048 · PubMed

Other PDB entries of the same protein (UniProt P35637 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6KJ3 0.6 Å, 120kV MicroED structure of FUS (37-42) SYSGYS solved from merged datasets at 0.60 A
6KJ1 0.65 Å, 200kV MicroED structure of FUS (37-42) SYSGYS solved from merged datasets at 0.65 A
6KJ4 0.65 Å, 120kV MicroED structure of FUS (37-42) SYSGYS solved from single crystal at 0.65 A
6KJ2 0.67 Å, 200kV MicroED structure of FUS (37-42) SYSGYS solved from single crystal at 0.67 A
5XSG 0.73 Å, Ultrahigh resolution structure of FUS (37-42) SYSGYS determined by MicroED
6BWZ 1.1 Å, SYSGYS from low-complexity domain of FUS, residues 37-42
6BXV 1.1 Å, SYSSYGQS from low-complexity domain of FUS, residues 54-61
6BZP 1.1 Å, STGGYG from low-complexity domain of FUS, residues 77-82
5XRR 1.5 Å, Crystal structure of FUS (54-59) SYSSYG
4FDD 2.3 Å, Crystal structure of KAP beta2-PY-NLS
6XFM 2.62 Å, Molecular structure of the core of amyloid-like fibrils formed by residues 111-214 of FUS
7CYL 2.7 Å, Crystal structure of Karyopherin-beta2 in complex with FUS PY-NLS(P525L)

Browse structure collections

About this viewer

MolViewer shows 5W3N directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.